KEGG   Vibrio anguillarum 775: VAA_02595Help
Entry
VAA_02595         CDS       T01536                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
van  Vibrio anguillarum 775
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAA_02595
   01230 Biosynthesis of amino acids
    VAA_02595
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAA_02595
   00051 Fructose and mannose metabolism
    VAA_02595
   00562 Inositol phosphate metabolism
    VAA_02595
Enzymes [BR:van01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VAA_02595
Exosome [BR:van04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VAA_02595
  Exosomal proteins of bladder cancer cells
   VAA_02595
  Exosomal proteins of melanoma cells
   VAA_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(553954..554751)
Genome map
AA seq 265 aa AA seqDB search
MIDNGDIPMRHPVVMGNWKLNGSKEMVVELLNGLNAELEGVTGVDVAVAPPALFIDLAER
TLTDAGSAIILGAQNSDVHNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHNESDEFVA
QKFAFLKENGLTPVLCIGESEAQNEAGETVAVCARQLDAVINTQGVEALEGAIIAYEPIW
AIGTGKAATADDAQRIHAAIRAHIAAKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGA
LVGGAALDAKSFAAIAKAAAEAKKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgatagataatggagatattcctatgcgtcatcctgtagttatgggtaactggaaacta
aacggcagcaaagagatggttgttgagctgctaaatggtctgaatgcagagcttgaaggc
gtaacgggtgttgacgtagccgttgctccacctgcactttttattgacctagcagagcgc
actctgaccgatgcgggtagcgcgatcattctgggtgcccaaaacagcgacgtacacaac
agtggcgcattcactggcgatatgtctccagcaatgctgaaagaattcggtgcaacacac
atcatcattggtcactctgagcgtcgtgaataccacaatgaatccgatgaatttgtggcg
caaaaatttgcattcctaaaagaaaatggcctaacaccagtactttgtatcggcgaatct
gaagcacaaaacgaagctggcgaaacagtagccgtatgtgcacgtcaacttgacgctgtg
atcaacactcaaggtgttgaagcgctagaaggtgcgatcatcgcttacgaaccaatctgg
gcgatcggcacaggtaaagcagcaacagcagatgatgctcaacgtattcacgctgccatt
cgcgcgcacattgctgcaaaatcagaagcagtcgcgaagaatgtcgttatccaatacggc
ggttctgtaaaacctgaaaacgcagcagcttacttcgcacaaccagacattgatggtgct
ctagttggcggcgcagcacttgatgcgaaaagctttgcagctatcgcaaaagcagcagct
gaagcgaaaaaagcgtaa

DBGET integrated database retrieval system