KEGG   Vibrio anguillarum 775: VAA_02760Help
Entry
VAA_02760         CDS       T01536                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
van  Vibrio anguillarum 775
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:van00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:van00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(699503..700432)
Genome map
AA seq 309 aa AA seqDB search
MVNSLYQKHIISIPELSRDELELIVKTAGQLKAEPKPELIKHKVVASCFFEPSTRTRLSF
ETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVQVISSYVDAFVMRHPQEGAARLASEFS
NGVPVINAGDGANQHPTQTLLDLFTIAETQGRLDNINIAFVGDLKYGRTVHSLTQALAKF
NHIRFFFVAPDALAMPDYICEELDDAGIEYSLHTDMESVIPQLDILYMTRVQKERFDESE
YAHIKSAYILTAAMLEGARDNLKVLHPLPRVDEITVDVDKTKHAYFFQQAENGVYAREAL
LALVLNETL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgaattcgctttatcaaaagcacattatttcgattccagagctctctcgtgatgag
ctggaattgattgtgaaaaccgcaggccaactcaaagcggaaccaaaaccagagctgatt
aagcacaaagtggtagcaagctgcttttttgagccgtcgactcgtactcgtttgtctttt
gaaaccgctattcaacgcatcggcggcagcgtgattggctttgataatggtggcaacacg
tcactggcgaaaaaaggcgaaacactggccgattcagtacaagtgatctcctcttatgtg
gatgcgtttgtgatgcgccacccccaagaaggcgcagcacgtttagcctctgaattttca
aacggcgttcctgtgattaacgctggcgacggtgccaaccagcacccaacccaaacactg
ctcgatttgttcaccattgccgaaacacaaggccgtttagataacattaatatcgccttt
gttggcgacttgaaatatggccgtaccgtccattctttaacccaagctttggctaaattt
aaccacattcgcttcttctttgttgcgccggatgcgctggctatgcctgactatatttgc
gaagagttagatgatgcaggcattgagtacagcctgcacaccgatatggaaagcgttatt
ccacagttagatattctgtatatgacgcgcgtccaaaaagagcgctttgatgaatcagag
tacgcgcacattaaatcggcgtacattttgacagccgccatgcttgaaggtgcgcgcgat
aacttaaaagtgctacatccgcttccgcgcgtggatgaaatcaccgttgatgtggacaaa
acgaagcacgcttacttcttccaacaagcagaaaacggggtctacgcccgtgaagctttg
ctggcgcttgtgttaaacgaaaccctgtaa

DBGET integrated database retrieval system