KEGG   Vibrio anguillarum 775: VAA_02760Help
Entry
VAA_02760         CDS       T01536                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
van  Vibrio anguillarum 775
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VAA_02760
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAA_02760
Enzymes [BR:van01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VAA_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(699503..700432)
Genome map
AA seq 309 aa AA seqDB search
MVNSLYQKHIISIPELSRDELELIVKTAGQLKAEPKPELIKHKVVASCFFEPSTRTRLSF
ETAIQRIGGSVIGFDNGGNTSLAKKGETLADSVQVISSYVDAFVMRHPQEGAARLASEFS
NGVPVINAGDGANQHPTQTLLDLFTIAETQGRLDNINIAFVGDLKYGRTVHSLTQALAKF
NHIRFFFVAPDALAMPDYICEELDDAGIEYSLHTDMESVIPQLDILYMTRVQKERFDESE
YAHIKSAYILTAAMLEGARDNLKVLHPLPRVDEITVDVDKTKHAYFFQQAENGVYAREAL
LALVLNETL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgaattcgctttatcaaaagcacattatttcgattccagagctctctcgtgatgag
ctggaattgattgtgaaaaccgcaggccaactcaaagcggaaccaaaaccagagctgatt
aagcacaaagtggtagcaagctgcttttttgagccgtcgactcgtactcgtttgtctttt
gaaaccgctattcaacgcatcggcggcagcgtgattggctttgataatggtggcaacacg
tcactggcgaaaaaaggcgaaacactggccgattcagtacaagtgatctcctcttatgtg
gatgcgtttgtgatgcgccacccccaagaaggcgcagcacgtttagcctctgaattttca
aacggcgttcctgtgattaacgctggcgacggtgccaaccagcacccaacccaaacactg
ctcgatttgttcaccattgccgaaacacaaggccgtttagataacattaatatcgccttt
gttggcgacttgaaatatggccgtaccgtccattctttaacccaagctttggctaaattt
aaccacattcgcttcttctttgttgcgccggatgcgctggctatgcctgactatatttgc
gaagagttagatgatgcaggcattgagtacagcctgcacaccgatatggaaagcgttatt
ccacagttagatattctgtatatgacgcgcgtccaaaaagagcgctttgatgaatcagag
tacgcgcacattaaatcggcgtacattttgacagccgccatgcttgaaggtgcgcgcgat
aacttaaaagtgctacatccgcttccgcgcgtggatgaaatcaccgttgatgtggacaaa
acgaagcacgcttacttcttccaacaagcagaaaacggggtctacgcccgtgaagctttg
ctggcgcttgtgttaaacgaaaccctgtaa

DBGET integrated database retrieval system