KEGG   Vibrio anguillarum 775: VAA_03164Help
Entry
VAA_03164         CDS       T01536                                 

Definition
RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
van  Vibrio anguillarum 775
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:van03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1385320..1385940
Genome map
AA seq 206 aa AA seqDB search
MIGRLRGILIEKQPPELLIEVAGIGYEVQMPMSCFYELPKLGEEAVIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTAGQFVSCVEREDISTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPATDAAPVDNNSLEALTSNAEEEAISALLSLGYKPQQA
SKVVAQVMKADMTSEALIKEALRAMV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggcattctgattgaaaagcaacctccagagctattgattgaa
gtcgctggcattggttatgaagtccaaatgccaatgagttgcttctatgaactccctaaa
ttgggcgaagaagcggtcatttatacccattttgtggtccgagaagatgcgcagctttta
tatggtttcaacacggtaaaagagcgagctttatttcgtgaagtgattaaagcgaatggc
gtcgggccaaaattaggcttgggtattttgtccggaatgacggccggtcaatttgtttca
tgcgttgagcgtgaagatatctccacattagttaagcttcctggcgtgggtaaaaaaacc
gctgaacgtttggttgttgagatgaaagataggctgaaaggttggggagccggtgacctc
ttcactcccgctactgacgctgcgccagtcgataacaattccttggaagcgctcacgagc
aatgcggaagaagaagcgatcagtgcgttactttctttgggttataagcctcaacaagct
tctaaagtagtggcacaagtaatgaaagctgacatgaccagtgaagcgctgattaaagaa
gccttgagagcaatggtatga

DBGET integrated database retrieval system