KEGG   Vibrio anguillarum 775: VAA_03354Help
Entry
VAA_03354         CDS       T01536                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
van  Vibrio anguillarum 775
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VAA_03354
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAA_03354
   00620 Pyruvate metabolism
    VAA_03354
   00650 Butanoate metabolism
    VAA_03354
  Lipid metabolism
   00071 Fatty acid degradation
    VAA_03354
  Amino acid metabolism
   00350 Tyrosine metabolism
    VAA_03354
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VAA_03354
   00626 Naphthalene degradation
    VAA_03354
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VAA_03354
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VAA_03354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1188104..1190776
Genome map
AA seq 890 aa AA seqDB search
MPVTNLAELDALVARVKAAQAEFSTYSQEQVDKIFRAASLAANQARIPLAQQAVAESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDKNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHEGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTF
DNGVVCASEQAVIVMDEVYDEVKERFASHKAHVLSKADADKVRKVLLIDGALNAKIVGQP
ATAIAEMAGVKVPADTKILVGEGIGEVSYDDEFAHEKLSPTLGMFRATSFENAVEQAVRM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKMKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAMSDLEGKKR
AFLVTDRFLFNNGYADDVVTLLKSNGMEVQTFFDVEADPTLSVVEKGAEAMKSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGQKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYKNGAADPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHIPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLTWLEELKKDLDIPLSIQAAGVNEADFLAKVDVLSVEAFDDQC
TGANPRYPLISELKEVLLAAYYGTAFVEGETFEGTTVIKKKDDQKPAKKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatttagctgaacttgatgctctagtagcgcgcgttaaagcggctcaa
gcagaattctctacttactctcaagagcaagtagataaaattttccgcgcagcatcatta
gcagctaaccaagctcgtatccctctagcgcaacaagcggtagcggaatcaggcatgggt
attgttgaggataaagtaatcaagaaccactttgcgtctgagttcatctacaacaaatac
aaagacgaaaaaacgtgtggcattcttgaagaagataaaaacctaggcacgatgactatc
gctgagcctgtaggcatcatctgcggtatcgttccaaccactaaccctacttctactgca
atcttcaaatctctcatctctttgaagactcgtaacggtatcatcttctcgccacaccca
cgtgcgaaaaattcaactaacgatgcagctaaactcgtgttagatgcagcagttgcagct
ggcgcgccaaaagatatcatcggctggattgatcaaccttcagttgagctatctaacgcg
ctaatgaagcacgaaggtattgcacttatccttgcaacaggtggtcctggcatggtgaaa
gcagcttactcgtcaggtaaaccagcaatcggtgtaggtgcaggtaacgttccagttgta
atcgacgaaacggcagacatcaaacgtgcagttgcttctgttcttatgtctaaaacattc
gataacggtgtggtatgtgcttctgagcaagcggttatcgttatggacgaagtgtatgac
gaagtaaaagaacgtttcgcgagccataaagcgcatgttttaagtaaagcagacgcagac
aaagtacgtaaggtactgcttatcgatggcgcactaaacgcgaaaatcgtaggccaacca
gcaacagccatcgctgaaatggcgggtgttaaagttccagcagatactaaaatccttgtc
ggtgaaggtattggcgaagtttcttatgacgatgaattcgcacatgaaaaactttctcca
acacttggcatgttccgcgcgacttctttcgagaacgcggtagaacaagccgtaagaatg
gtagaaatcggcggtatcggccacacttctggtctatacactaaccaagacgttaatgca
gaccgtatccgttactttggtgacaaaatgaagacggcgcgtattcttgtaaacatccca
accactcatggtggtatcggtgacctttacaactttaacgttgcaccatctctaacgcta
ggttgtggttcttggggtggtaactcgatttctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaacatgttgtggcataaactacctaagtca
atttacttccgtcgtggtagccttccaatcgctatgagcgatcttgaaggcaaaaaacgc
gcattcctagttactgaccgtttcctattcaacaacggttatgcagacgacgtagtgact
ctgctgaagtcaaacggtatggaagttcaaacattctttgatgtagaagctgatccaact
ctatctgtcgtagagaaaggcgctgaagcaatgaagagtttccaaccagacgtgattcta
gcacttggtggtggttcaccaatggatgcggcgaagatcatgtgggttatgtatgagcac
ccagaaactcactttgaagagcttgcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtcaaaaagcagaattggtttgtatcacgactacttcaggtaca
ggttcagaagtcacaccatttgccgttgtaacagacgacaaaacaggtgctaaataccca
ctagcggattatgagctaacacctaacatggctatcgttgatgcgaaccttgtgatgaat
atgcctaagtctctaacggcatttggtggttacgatgctgtgactcacgctcttgaagcc
tatgtatctgttcttgcgaacgaatactctgatggtcaagctctacaagcacttaagatg
ctgaaagagtacctaccatcaagctacaaaaatggcgcagcagacccaattgctcgtgaa
aaagtgcacaatgcagcgactatcgcaggtattgcttttgctaacgcgttcttaggtgta
tgtcactctatggcgcacaagatcggtgctgagttccacatcccgcacggccttgctaac
gcattgcttatctctaacgttgtgcgctataacgcgaatgataacccaaccaaacaaact
gcgttctctcaatacgaccgtccacaagcacgccgtcgttacgctgaagtggctgaccac
ttaggcttgagccaagcgggcgaccgtactgctcagaagattgaacgtctactgacttgg
ttggaagagctgaagaaagatctcgacatcccgctatctatccaagcggctggcgtgaat
gaagcggatttcctcgcaaaagttgacgtactatcagttgaagcgtttgatgaccaatgt
actggtgcaaacccacgctacccactgatttctgagctaaaagaagtacttcttgcggct
tactatggtacagcgtttgttgaaggtgaaactttcgaaggcactaccgttatcaagaag
aaagatgaccaaaaaccagcaaagaaaaagtaa

DBGET integrated database retrieval system