KEGG   Vibrio anguillarum 775: VAA_03409Help
Entry
VAA_03409         CDS       T01536                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
van  Vibrio anguillarum 775
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:van01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:van00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:van00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1129050..1130258
Genome map
AA seq 402 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGEAVARDEVLVEIETDKVILEVPAPEAGVLEAII
EQEGATVLSKQLLAKLKPGAVAGEPTKDTTNDTEPSPDKRHKATLTDETNDALSPAVRRL
LAEHGLEASQVKGSGVGGRITREDIDAHLAAAKSASAVASSQPEPVVAMARSEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYQGLFEEKHGIRLGFMSFYVKAVT
EALKRYPEVNASIDGQDIVYHSYFDISMAVSTPRGLVTPVLKDCDTLSLAEIEKGIKELA
LKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRPMAVDGKVE
ILPMMYLALSYDHRLVDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatctacctgaatcagtggctgatgcaacagtcgcg
acatggcataaaaagccaggtgaagccgtcgctcgtgatgaagtactcgttgagattgaa
actgataaagtaattcttgaagtgccagcgcctgaggcgggtgttctcgaagccattatc
gagcaagaaggtgcgacggtgctttcgaaacagttattggcgaaattaaaacccggtgcc
gttgcaggtgaaccgacgaaagataccaccaacgatacagagccgtctcctgataaacgc
cacaaagccacattgacagacgaaacgaatgatgcacttagccctgcggtacgccgttta
ctcgccgagcatggtttggaagcaagccaagtgaaaggctctggtgtgggtgggcgtatc
acgcgtgaagatattgatgctcatctagcagccgcaaaatcagcgtcagcagttgcttca
agtcaacctgagcctgtcgttgcgatggcgcgtagtgaaaaacgtgtaccgatgacgcgt
ttgcgtaaacgtgttgcggagcgcctgcttgaggcaaaaaatagcacggcgatgttgacg
acgtttaatgaagttaacatgaagcctatcatggatcttcgtaagcaatatcaaggtctg
tttgaagagaaacacggtattcgtttaggctttatgtctttctacgtgaaagcggtaaca
gaagcgttaaagcgttacccagaagtgaatgcatctattgatggccaagatattgtgtat
cacagctattttgatattagcatggcagtttcaacgcctcgtggcttagtgactccggtt
cttaaagattgcgatacgctaagccttgccgaaattgagaagggcatcaaagagcttgca
ctcaaaggaagagatggcaaattgacggttgaagaactgactggcggtaatttcacaatt
acgaatggcggtgtgtttggatcgttaatgtcaacaccgatcatcaatccgccgcaagcg
gccatattgggcatgcacaaaatccaagaccgcccaatggctgtggatggcaaagtagaa
attttaccaatgatgtacctagcactttcttacgaccaccgtttggtggatggccgtgag
tcagttggtttccttgtgacagtaaaagagctacttgaagatccagcacgtctgctactg
gacgtgtaa

DBGET integrated database retrieval system