KEGG   Vibrio anguillarum 775: VAA_03506Help
Entry
VAA_03506         CDS       T01536                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
van  Vibrio anguillarum 775
Pathway
van00900  Terpenoid backbone biosynthesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAA_03506
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VAA_03506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEH32571
UniProt: F7YN10
Position
I:complement(1048171..1048755)
Genome map
AA seq 194 aa AA seqDB search
MGGGIGGGSSNAATVLVALNYLWQTNLSQQELATLGLTLGADVPVFVHGFAAFAEGVGEK
LTQTEPKQKWYLVVRPNVSIATKDIFTHPQLIRNTPKRALATLLEHPYENDCEKIVRMLY
PEVDKQLSWLLQYAPSRLTGTGSCVFAEFSSKVEAEAVLAKLPDTVFAFVALGCNISPLK
KTLAEYQFANTRPI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtggcatcggtggcggctcttccaatgctgcaaccgtgcttgttgcactgaac
tacttatggcaaaccaatttatcacagcaagaactcgctacgctcggtttaacactcggg
gcggatgttcccgtttttgtccatggctttgccgcatttgctgaaggcgtaggtgaaaaa
ctgacccaaaccgaaccaaagcaaaaatggtatttggtggttcggcctaatgtgagcatt
gcaacgaaagatattttcactcacccccaattgataaggaacacgccaaaacgagcgcta
gcaacgcttctcgaacacccttacgaaaacgattgcgaaaaaattgtccgaatgctgtac
ccagaggttgataagcaactttcatggctgctacaatacgcgccgtcaagattgactggg
acgggatcttgcgtttttgccgaattttctagcaaagtagaagcggaagctgtccttgcc
aagctccctgacacagtcttcgcgtttgtcgccttagggtgtaacatttcgccactgaaa
aagactctggctgaataccaattcgccaacacccgacctatttaa

DBGET integrated database retrieval system