KEGG   Vibrio anguillarum 775: VAA_03539Help
Entry
VAA_03539         CDS       T01536                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
van  Vibrio anguillarum 775
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VAA_03539
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VAA_03539
Enzymes [BR:van01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VAA_03539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1013420..1016173
Genome map
AA seq 917 aa AA seqDB search
MYGECLRSQAFMLVAVLSPFNRILGFYFKGRVSQMLKPSLIAVSVIATLSGCSLLQSPEQ
KVVDALAENLDIHYTVLTNHGADEGLACQALEAEWASCNKVNMTLVNQGEAVNSKQWAIY
FHSIRLILDVENDQFKITRLTGDLHKLEPTDKFDGFAAGEEVVLPLVAEYWQLFETDFMP
RAFVAAPNTEPKLIVSLNTEDTSSFVRGLEGDNIKRTASDNNVFATAISRFERNSDVSLQ
DVSTALLPTPLKTTLGQGVVDINRGLKLDVKDFATDQFSALQARAKTIGLKLDGELAVGV
AITPSEFSDQMATSGAYELEIAPNAISIRAFDEAGAFYAVQSILGLVDSQNVTALPAIRI
EDAPRFDYRGVMVDVARNFHSKQAILATLDQMAAYKMNKLHLHLTDDEGWRLEIPGLPEL
TDIGGQRCFDLDEKNCLLPQLGSGPNSDNFGSGYFSRADYIEILKHAKARNIEVIPEIDM
PAHARSAVVSMEARFDRLAQEGKTEQASQYRLMDPQDSSNVTTVQFYDKQSFINPCLDSS
KRFVDKVITEVALMHSEAGMPLSTWHFGGDEAKNIKLGAGFQDINATEKVSWKGNLDLSQ
QDKPFAKSPQCQALVSQGVVSDFAHLPSYFAEQVSEIVADKGIENFQAWQDGLKYSEGES
SFATRNTRVNFWDVLYWGGTSSVYEWAKQGYDVIVSNPDYVYMDMPYEADPKERGYYWAT
RATDTRKMFGFAPENMPQNAETSLDRDGNGFVGKGEMTSKPFYGLSAQLWSETVRNDGQY
EYMVFPRVLAAAERAWHKAEWENDYKVGVEYSQQTNLVNKSALNQDWTRFANIVGQRELA
KLEKAGIDYRLPIPGAKIEAGKLSMNSSFPGVELQYSLDGQQWLTYSSIEQPKVSGEVWI
RSISASGERVSRVTSVK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
ttgtatggtgaatgccttaggtcacaagcctttatgcttgttgctgttttgagtcctttt
aacaggatattgggtttttattttaaaggtagggtgagtcaaatgttgaaacctagtttg
attgctgtttcggttatcgccacattatcaggttgctctttgttgcaatcaccagagcag
aaagtagtcgatgcgctggcggaaaatttggatattcattacaccgtattaacgaatcac
ggggcagatgaaggattggcatgtcaggctctcgaagcagaatgggcatcgtgtaataaa
gtgaacatgaccttggttaaccaaggtgaagccgtgaattcaaagcagtgggctatctat
ttccacagtattcgactgattctggatgttgaaaatgatcaattcaaaattacccgttta
acgggtgatttacataagcttgaacctactgataaatttgatggttttgctgcgggcgaa
gaggttgttttgcctctggtcgctgaatattggcagttgtttgaaacggactttatgccg
cgtgcattcgttgcggcacctaatacagagcctaaacttattgtatctctcaacacagag
gacacgtcgtcatttgtgcgtggacttgagggtgacaatataaaacgcaccgccagcgat
aataatgtgtttgccacggccatcagccgatttgagagaaatagcgatgtatcactgcaa
gatgtatcaacggctctgttaccaacgcctctaaaaacaacgctcggtcaaggtgttgtt
gacattaatcgcggccttaagcttgatgtgaaggactttgcgacggatcagttttcagca
ttgcaagcgcgtgctaaaacgattgggctgaagcttgatggagagttggcggttggtgtt
gcgattacaccgagcgaattttctgaccagatggcgacatcgggtgcttatgagttggag
attgcaccgaatgctatctctattcgtgcatttgatgaggcgggagctttctacgccgtt
caatctattttgggtttagtggatagccagaatgtcacagcgctgccagcgatccgcatc
gaagatgctccacgttttgattaccgtggtgtgatggtggatgtcgcacgtaacttccat
tctaagcaagcgattttggccacgttagatcaaatggcggcttataagatgaataaatta
catcttcatttgaccgatgatgaaggttggcgtttagaaattccgggcttacctgaattg
accgacattggtggacagcgctgctttgatttagatgagaaaaactgcttgctgccacag
cttggctccggtccaaattctgataactttggctcaggttattttagtcgagccgattac
attgaaatcctcaagcacgctaaagcgcgcaatattgaagtgatccctgaaattgatatg
ccagcccatgctcgctctgcggttgtttcaatggaggctcgttttgatcgtttggcccaa
gaggggaaaaccgaacaggctagccagtatcgcttgatggatcctcaagacagttccaat
gttacgacggttcagttttatgataagcagagttttattaacccttgtttagactcgtct
aaacgttttgtggacaaggtgatcactgaagtggccttgatgcacagtgaggcgggcatg
cctttatcgacttggcattttggtggcgatgaggcgaaaaacatcaaattaggcgcgggt
ttccaagatattaatgcgacggaaaaagtcagttggaaaggtaacttagatctttcacaa
caagataaaccatttgcgaaatcgccacagtgccaagcattagtcagccaaggagtagta
agtgactttgctcatttaccgagttattttgctgagcaagtgtcggaaattgtcgccgat
aaagggattgagaatttccaagcatggcaagatggcttgaaatacagcgagggagaatcc
tcttttgccacgcgcaatacacgtgtgaacttttgggatgtcctctattggggcggtaca
agctctgtttatgaatgggcaaaacaaggttacgacgtaattgtttctaaccctgattat
gtctacatggatatgccttatgaagcggatcctaaagagcgcggttattactgggccacc
cgtgcgaccgatacgcgcaaaatgtttggttttgcaccggaaaatatgccgcaaaacgct
gaaacttcattagatcgtgatggtaatggttttgtcggtaaaggagagatgacgtcgaaa
ccattctacggcttgtcagctcaattgtggtcagaaacggttcgtaatgatgggcagtat
gaatatatggttttccctcgagtgttggctgccgctgaacgtgcttggcataaagcggag
tgggaaaacgactataaagtaggggttgaatattctcagcaaaccaacttagtcaataag
tctgcactgaatcaagattggactcgttttgctaatattgttgggcaacgtgagctggcg
aaactggaaaaagctggcattgattatcgcctgccaattcccggagctaagattgaagcg
ggtaaattgtcgatgaattcgtcattcccaggtgttgagctgcaatactcattagatggt
caacaatggcttacttactcgagcattgaacaaccgaaggtgtccggtgaggtctggatc
cgttctatctctgcttcaggcgagcgagtcagccgagttactagcgttaaataa

DBGET integrated database retrieval system