KEGG   Vibrio anguillarum 775: VAA_03571Help
Entry
VAA_03571         CDS       T01536                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
van  Vibrio anguillarum 775
Pathway
van00900  Terpenoid backbone biosynthesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAA_03571
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     VAA_03571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP NAD_binding_3 NmrA Epimerase
Motif
Other DBs
NCBI-ProteinID: AEH32512
UniProt: F7YMP1
Position
I:979727..980935
Genome map
AA seq 402 aa AA seqDB search
MRKLTILGATGSIGASTLKVVAQNPEHFSVVALAAGNNVSKMRELCQRWQPVYAVMANQK
AADELLAQLQSLNLKTTVLFGEDAMCHVAALDEVDTVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGQLFIDAVEKHGAELLPVDSEHNAIFQCLPPEIQGSLGRCDLQEHGVQH
ILLTGSGGPFRYSDLSSLADVSPQQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFN
ASKQQLKVLIHPQSVIHSMVQYRDGSVLAQMGEPDMSTPIALTLSYPERITAGVPALDFT
KLSNLSFMDVDYERYPCLGLAIDACYQGQHATTSLNAANEIAVEAFLNKQIRFTDIAQVN
ERVLSKVCAAHTRLHCYDLESLLELDRMARTIAQQIIQEHLL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagttaacgattctcggggccacaggttcaattggggcaagcacattaaaagtc
gtagctcaaaatcccgaacacttttccgttgtggctttagccgcgggaaataatgtcagt
aaaatgcgtgagctatgccagcgttggcagccagtttatgcggtaatggcgaaccaaaag
gcggcggatgagcttttagctcaattgcagtcactgaacttaaaaacaaccgtattattt
ggtgaagacgccatgtgccacgtcgccgcattagatgaggtggataccgtgatggcggcg
attgttggtgcggcaggtttgttaccaaccatggctgcggtaaaggcaggcaagcgtgtt
ttgctggcaaacaaagaagccttggtgatgtctggccaattgtttattgatgcggtcgaa
aaacacggtgcggaattgctccctgtcgatagcgaacataacgcgatttttcaatgctta
ccccctgaaattcaaggctctttgggtcgctgtgatttacaagaacatggtgtgcaacat
attctgctcacgggttctggcggcccttttcgctacagtgatttatcctcgttagctgat
gtttcaccacagcaagcgattgctcatcctaactggtcgatggggccgaaaatttcggtt
gattccgctaccatgatgaacaaaggtttggaatatattgaagctaagtggttgtttaat
gcatcgaaacagcaattaaaagtgttaatccacccacagtcggtgatccactctatggtg
cagtaccgcgatggttcggtgcttgcgcaaatgggggaacccgatatgtccacgccaatt
gctttaactctctcttatccagaacgcattactgcgggtgttccggcactggattttacc
aaattaagtaatttgagttttatggatgtggactacgagcgttatccttgtttgggattg
gcgattgatgcttgctatcaagggcaacatgccaccacctctttaaatgcagccaacgaa
atagccgttgaagcttttttaaataagcaaattcgttttaccgatatcgcacaagttaat
gaacgtgtattgtcaaaagtgtgtgcagcacatactcggttacattgctatgacttggaa
agcttgttagagctcgatagaatggcgcgcactattgcccagcaaatcatacaagagcat
ttattatga

DBGET integrated database retrieval system