KEGG   Vibrio anguillarum 775: VAA_03593Help
Entry
VAA_03593         CDS       T01536                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
van  Vibrio anguillarum 775
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:van01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:van00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:961451..962614
Genome map
AA seq 387 aa AA seqDB search
MFSISEEIMTTNQQSGKAVQLQTIVVKLGTSVLTGGTLALDRAHMVELVRQCAELKKQGH
SVVIVSSGAIAAGREHLGYPALPNAMASKQLLAAVGQSQLIQAWESLFAIYGIKIGQMLL
TRADLEDRERFLNARDTINALVEHDIIPVVNENDAVATSEIKVGDNDNLSALVGILCGAD
KLLLLTDQKGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADI
ARRAGIEVIIAAGRASNVIFDSLSDAPQGTRFLPCTEALENRKRWILAGPAASGDIVIDG
GAVNAVVANGSSLLAKGVVNVSGTFARGEVARVTDKQGVLIARGIAAYSSQDLAKIAGKH
SKDIGGILGYDYGSEVIHRDDLVVIQE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgttttccatttcagaagaaatcatgacaacgaatcaacaaagcggaaaagcggtgcaa
cttcaaacaatcgttgtgaagctaggaaccagtgtattaaccggtggtactttggcgtta
gatagagctcatatggttgagcttgtccgtcaatgtgctgaactgaaaaagcaaggccac
tcagtggtgattgtatcgtcgggcgcaattgccgctggtcgagaacacttaggttacccc
gcactccccaacgcaatggctagcaaacagttgcttgctgcggttgggcagagtcaactg
attcaagcatgggaatctctttttgccatctatgggattaaaataggtcaaatgctactg
actcgtgccgatctagaagatcgtgagcgttttttgaatgcgcgagataccattaatgct
ttggtcgagcacgatattattcctgtggtcaacgaaaacgatgccgtggcaaccagtgaa
atcaaagtgggcgacaacgacaatttgtcagccttggttggtatcttatgtggtgccgat
aaactattgctgctgactgaccaaaaagggctcttcaccgcagacccgcgtaaagatcct
aacgctgaactgattaaagaagtcaaaaccattgatgataccttgcgtaaaatcgctggg
ggtagtggtaccacgcttggcaccggaggtatggcaactaagcttcaggccgctgatatt
gctcgtcgtgcagggattgaagtcattatcgccgcagggcgtgccagcaacgttattttt
gactctttaagtgatgcgccacaaggcacccgtttcttgccatgtaccgaagcgttagaa
aaccgcaaacgctggattttagcgggtcctgccgcttctggtgacattgtcattgatggc
ggagccgtcaacgctgtagtcgcgaatggcagtagcttattagcgaaaggggtagtgaat
gtcagtggtacttttgcacgtggtgaagtggcgcgagtaaccgataaacaaggcgtatta
attgcccgtggcatcgccgcttattccagtcaagatttagccaaaatcgcgggcaaacac
agcaaagatatcggaggcattttaggttacgattatggctcagaagtcattcatcgcgat
gatcttgttgtgatccaagaatag

DBGET integrated database retrieval system