KEGG   Vibrio anguillarum 775: VAA_03635Help
Entry
VAA_03635         CDS       T01536                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
van  Vibrio anguillarum 775
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:van03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:922231..924357
Genome map
AA seq 708 aa AA seqDB search
MSSTLMITLKQLAEKGAMRQLDYQFARFIEQKSQQQLGAEHSQALGFIAAVVSAELAKGH
ICLPLVDASTAQGVDLAAKLGLFGEAALAINQHLLVIDWPWLLNRSDLVGQQGEAVPLMF
DGQRLYLHRYWHYEVTLAQRLISFGTPMSLKPTDVQKLKLLLDTLFARQYHFLLHALRQL
PETANASACQQQVCDFLDVVNADELDWNEIEQVISQARTAKELEALETLIPQSVCINWQK
VAAAVALTRRFAVISGGPGTGKTTTVTKLLAALITQAQQQGETPTIKLVAPTGKAAARLT
ESIGKAVAELAVEPALKAAIPTESSTLHRLLGVIPNSVEFRHHQRNPLHLDILVVDEASM
VDLPMMVKLIEALPKHARLILLGDKDQLASVEAGAVLGDICSFLTLGYSRAHSEYLAKLT
GYQTLIAHSHPNVTPISDSLCMLKKSYRFDVRSGIGQFAKAINAGQVAMVDEVLKRNYAD
ITHHSLSSESYNLMLKTLVKEYGRYLTRIESSGAYTAETQAQKAKAVLDCFNQCRLLCAI
REGDFGVSGLNQRIERALIARKLIKTQDEIWYHGRPVMVARNDHGLGLYNGDIGICMLDT
SEQEPRLKVYFELPDGSVKAILPSRVPEHETAYAMTIHKSQGSEFDLTLMILPPDFSPIL
TRELIYTGITRAKKQLMLFADMGTMKRGLKIKTQRASGLVTRLDKRLA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtacgctaatgataacgcttaagcagttagcggaaaaaggcgctatgcgtcag
ttagattaccaattcgcgcgttttatcgaacaaaaaagccagcagcaacttggcgctgaa
catagccaagcgctcggatttattgccgcggtggtcagtgctgaattggccaaggggcat
atctgcttacctttagtggatgcttcaacggcacagggtgtcgacctcgcagctaagtta
ggcttgtttggtgaggcagcattggcgatcaatcagcacctattggtgattgattggcct
tggctactcaaccgttcagacttagtcggacaacaaggggaagcggtgcctttaatgttt
gatgggcaacgtttatatctacaccgttattggcattatgaagttaccttagcacagcgt
ttaatcagctttgggacacccatgagcctaaagcctactgatgtccaaaagctaaaattg
ctgctagatacactgtttgcgcgtcaataccactttctgctccatgcgcttcgtcaattg
ccagagacagccaatgcatcagcatgccagcaacaagtgtgtgattttctggatgtggtc
aacgccgatgaacttgattggaatgagattgagcaagtcattagccaagcacgtacggcg
aaagaacttgaagcattagagacgctgatcccgcaaagcgtttgcatcaactggcaaaaa
gtcgcagcggcagtggcactgacacgccgctttgccgtgatttctggcgggccgggaacc
ggtaaaaccaccacggttaccaaattactagccgctttgattacccaagcccaacagcaa
ggtgagacgcccaccattaaattggtcgcaccaacgggtaaagctgcggcacgtttgacg
gaatcgatcggtaaagcggtggctgaactggcggttgagccggcgttgaaagcggcgatt
cccaccgagtcgagcactcttcaccgtttattgggcgtcatacctaacagtgttgagttt
cgtcaccatcagcgtaacccgctgcatttagatatattggtggttgatgaagcatcgatg
gtcgatttaccgatgatggtcaagttaatcgaggcattacccaaacacgcacgcttgatt
ttactaggtgataaagaccaactcgcgtcagtcgaagcgggcgctgtgctgggggacatt
tgttcatttttgaccttaggctacagccgagcgcacagcgagtacctagctaagttaaca
ggctatcaaacactgattgctcattcacaccctaacgtaaccccgatttcagacagttta
tgcatgctgaaaaaaagctaccgctttgatgtccgatcaggcattggtcaattcgcaaaa
gcgatcaatgctgggcaagtggctatggtggatgaggtgttaaaacgcaattatgctgat
attacgcaccactcactcagcagtgaaagctataacctaatgctgaaaaccttagtcaag
gagtatggtcgttatctcacgcgcatcgagagttctggtgcttatactgcggaaactcaa
gcccaaaaagccaaagccgtattggattgctttaatcaatgccgtttgctttgcgctatt
cgtgaaggggattttggggtaagtggtttgaatcaacgtattgaacgtgcgctgatcgca
cgtaagttgattaagactcaagatgagatttggtatcacggccgacccgtgatggtggcg
cgtaacgatcatgggctgggtttgtataatggtgatatcggcatatgcatgcttgatacg
agcgagcaagaaccgcgtttgaaagtgtattttgagctgccagatggtagcgtgaaagcc
attttaccaagccgcgtaccagagcacgaaacagcctatgcgatgaccatccataaatca
caaggcagtgagtttgatctaacgctgatgattttaccgcctgattttagcccgatattg
accagagagcttatctatactggcattacgcgcgccaagaagcagctgatgctttttgct
gacatgggaacgatgaaacgagggctcaagataaaaacgcagcgagccagcggcttagtt
acgagattagacaagagactagcgtaa

DBGET integrated database retrieval system