KEGG   Vibrio anguillarum 775: VAA_03635Help
Entry
VAA_03635         CDS       T01536                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
van  Vibrio anguillarum 775
Pathway
van03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:van00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VAA_03635
Enzymes [BR:van01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VAA_03635
DNA repair and recombination proteins [BR:van03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VAA_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 UvrD-helicase DUF2075 AAA_22 UvrD_C AAA_28 AAA_16 T2SSE MukB AAA_29 ATPase TrwB_AAD_bind CbiA FtsK_SpoIIIE DUF3336 RNA_helicase NTPase_1 DUF87 DEAD AAA
Motif
Other DBs
NCBI-ProteinID: AEH32451
UniProt: F7YJY0
Position
I:922231..924357
Genome map
AA seq 708 aa AA seqDB search
MSSTLMITLKQLAEKGAMRQLDYQFARFIEQKSQQQLGAEHSQALGFIAAVVSAELAKGH
ICLPLVDASTAQGVDLAAKLGLFGEAALAINQHLLVIDWPWLLNRSDLVGQQGEAVPLMF
DGQRLYLHRYWHYEVTLAQRLISFGTPMSLKPTDVQKLKLLLDTLFARQYHFLLHALRQL
PETANASACQQQVCDFLDVVNADELDWNEIEQVISQARTAKELEALETLIPQSVCINWQK
VAAAVALTRRFAVISGGPGTGKTTTVTKLLAALITQAQQQGETPTIKLVAPTGKAAARLT
ESIGKAVAELAVEPALKAAIPTESSTLHRLLGVIPNSVEFRHHQRNPLHLDILVVDEASM
VDLPMMVKLIEALPKHARLILLGDKDQLASVEAGAVLGDICSFLTLGYSRAHSEYLAKLT
GYQTLIAHSHPNVTPISDSLCMLKKSYRFDVRSGIGQFAKAINAGQVAMVDEVLKRNYAD
ITHHSLSSESYNLMLKTLVKEYGRYLTRIESSGAYTAETQAQKAKAVLDCFNQCRLLCAI
REGDFGVSGLNQRIERALIARKLIKTQDEIWYHGRPVMVARNDHGLGLYNGDIGICMLDT
SEQEPRLKVYFELPDGSVKAILPSRVPEHETAYAMTIHKSQGSEFDLTLMILPPDFSPIL
TRELIYTGITRAKKQLMLFADMGTMKRGLKIKTQRASGLVTRLDKRLA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtacgctaatgataacgcttaagcagttagcggaaaaaggcgctatgcgtcag
ttagattaccaattcgcgcgttttatcgaacaaaaaagccagcagcaacttggcgctgaa
catagccaagcgctcggatttattgccgcggtggtcagtgctgaattggccaaggggcat
atctgcttacctttagtggatgcttcaacggcacagggtgtcgacctcgcagctaagtta
ggcttgtttggtgaggcagcattggcgatcaatcagcacctattggtgattgattggcct
tggctactcaaccgttcagacttagtcggacaacaaggggaagcggtgcctttaatgttt
gatgggcaacgtttatatctacaccgttattggcattatgaagttaccttagcacagcgt
ttaatcagctttgggacacccatgagcctaaagcctactgatgtccaaaagctaaaattg
ctgctagatacactgtttgcgcgtcaataccactttctgctccatgcgcttcgtcaattg
ccagagacagccaatgcatcagcatgccagcaacaagtgtgtgattttctggatgtggtc
aacgccgatgaacttgattggaatgagattgagcaagtcattagccaagcacgtacggcg
aaagaacttgaagcattagagacgctgatcccgcaaagcgtttgcatcaactggcaaaaa
gtcgcagcggcagtggcactgacacgccgctttgccgtgatttctggcgggccgggaacc
ggtaaaaccaccacggttaccaaattactagccgctttgattacccaagcccaacagcaa
ggtgagacgcccaccattaaattggtcgcaccaacgggtaaagctgcggcacgtttgacg
gaatcgatcggtaaagcggtggctgaactggcggttgagccggcgttgaaagcggcgatt
cccaccgagtcgagcactcttcaccgtttattgggcgtcatacctaacagtgttgagttt
cgtcaccatcagcgtaacccgctgcatttagatatattggtggttgatgaagcatcgatg
gtcgatttaccgatgatggtcaagttaatcgaggcattacccaaacacgcacgcttgatt
ttactaggtgataaagaccaactcgcgtcagtcgaagcgggcgctgtgctgggggacatt
tgttcatttttgaccttaggctacagccgagcgcacagcgagtacctagctaagttaaca
ggctatcaaacactgattgctcattcacaccctaacgtaaccccgatttcagacagttta
tgcatgctgaaaaaaagctaccgctttgatgtccgatcaggcattggtcaattcgcaaaa
gcgatcaatgctgggcaagtggctatggtggatgaggtgttaaaacgcaattatgctgat
attacgcaccactcactcagcagtgaaagctataacctaatgctgaaaaccttagtcaag
gagtatggtcgttatctcacgcgcatcgagagttctggtgcttatactgcggaaactcaa
gcccaaaaagccaaagccgtattggattgctttaatcaatgccgtttgctttgcgctatt
cgtgaaggggattttggggtaagtggtttgaatcaacgtattgaacgtgcgctgatcgca
cgtaagttgattaagactcaagatgagatttggtatcacggccgacccgtgatggtggcg
cgtaacgatcatgggctgggtttgtataatggtgatatcggcatatgcatgcttgatacg
agcgagcaagaaccgcgtttgaaagtgtattttgagctgccagatggtagcgtgaaagcc
attttaccaagccgcgtaccagagcacgaaacagcctatgcgatgaccatccataaatca
caaggcagtgagtttgatctaacgctgatgattttaccgcctgattttagcccgatattg
accagagagcttatctatactggcattacgcgcgccaagaagcagctgatgctttttgct
gacatgggaacgatgaaacgagggctcaagataaaaacgcagcgagccagcggcttagtt
acgagattagacaagagactagcgtaa

DBGET integrated database retrieval system