KEGG   Vibrio anguillarum 775: VAA_03670Help
Entry
VAA_03670         CDS       T01536                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
van  Vibrio anguillarum 775
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VAA_03670
Enzymes [BR:van01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VAA_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:881513..882874
Genome map
AA seq 453 aa AA seqDB search
MLGRQLMYSTQTFLPQEIIRKKRDGEILTTEEINFFIQGVANNTVSEGQIAAFAMTIFFN
EMTMPERIALTCAMRDSGMVINWDAMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFV
PMISGRGLGHTGGTLDKLESIPGYNITPSNDVFGQVTKEAGVAIIGQTGDLAPADKRVYA
TRDITATVDNISLITASILSKKLAAGLDSLVMDVKVGSGAFMPTYEASEELAKSIVAVAN
GAGTKTTAILTDMNQVLASSAGNALEVREAVRFLTGEYRNPRLLEITLASCVEMLLLGNL
AKDSNDARAKLMAVLNNGKAAECFGKMVKGLGGPADFVENYDHYLEKTELVKPVYALESG
VVSAMDTRAIGMAVVEMGGGRRVATDTIDYAVGFDQFIRLGDVADSSKPLAVIHARNEAQ
WQQAAKALQSAIQIGGEYTPTPDVYGQIRAEDV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggaggcaactaatgtactcaactcaaacttttttacctcaagaaatcattcgc
aaaaagcgtgacggcgagatcctcaccaccgaagaaattaacttttttattcaaggtgtg
gcgaataataccgtctctgaaggccaaattgcggcctttgccatgacgattttcttcaat
gaaatgactatgccagagcgcattgcactgacgtgcgctatgcgtgattctggaatggtg
atcaactgggatgcgatgaacttcggtggccctatcgttgataaacactcaactggcggc
gtaggcgatgtcacttcgctgatgcttggccccatggtcgcagcctgcggtggttttgtc
cctatgatttcagggcgcggccttggtcatacgggcggcacgctggataaattggagtcg
attcccggttataacatcactccaagtaatgacgtatttggtcaagtaaccaaagaagcg
ggcgttgctatcatcggccaaacgggtgatctcgcgccagcggataaacgcgtatacgcc
acacgtgacattaccgcaacggtcgacaacatttcactcatcaccgcctcgattctttct
aaaaaattagccgctgggttagattccttggtgatggatgtcaaagtcggctctggcgca
tttatgccgacttacgaagcttctgaagagttagctaaatctatcgtcgcagtggctaac
ggcgctggtacgaaaaccacggctattttaacggatatgaaccaagtgctggcctcttcg
gcaggcaatgcccttgaagtgcgtgaagcggtacgctttttaactggtgaatatcgcaat
cctcgcttactggaaattaccttggcctcttgcgttgaaatgttgttattaggcaattta
gcaaaagacagcaatgatgctcgtgcgaaactgatggccgttcttaataacggaaaagcg
gctgaatgctttggcaaaatggtcaaagggttaggcggccccgctgattttgttgaaaat
tacgatcactatcttgaaaaaaccgagctggttaagcccgtttacgctctagaaagtggc
gtcgtatcggcaatggatactcgcgcgattggcatggccgtggtggagatgggcggtgga
cgccgcgtcgcaactgacactattgattacgcggttgggtttgaccaatttattcgccta
ggtgacgttgccgatagcagtaagccgttggcggtgatccatgcgcgtaatgaagcgcaa
tggcaacaagcggccaaagcattacaaagcgccattcaaattggcggagaatacacacca
acacccgatgtctacggccaaattcgcgcagaagacgtataa

DBGET integrated database retrieval system