KEGG   Vibrio anguillarum 775: VAA_03682Help
Entry
VAA_03682         CDS       T01536                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
van  Vibrio anguillarum 775
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAA_03682
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAA_03682
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VAA_03682
Enzymes [BR:van01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VAA_03682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:869772..871055
Genome map
AA seq 427 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPQFEDIDALLAEDFISRSTKILSAL
IGDELPAEQVNAMVDAAFQFPAPIKQVKDGIYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGQITILTATSGDTGAAVAHAFYGMPDIKVVILYPKGKISPLQEKLFCTLGNNIHTVAV
NGDFDACQALVKQAFDDAKLRQEIGLNSANSINISRLMAQICYYFEAASQLSKAQRENLV
ISVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGQWDPKPTVATTSNAMD
VSQPNNWPRIEELCRLKGWGLDTLGKGAVSDAQSADSVRELYAQGYLCEPHGAIAYRVLD
EQLQAGETGLFLCTAHPAKFKEVVDDVLGTDIELPAPLAKHAVMALLSEELDNDFDALKT
VLRRVQP
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaacataaaagaaaatgatgaacaagtctcttttggccaagccgtacgc
caaggattaggacgcaatcaagggctatttttcccagcagagttgcctcagtttgaagat
attgacgcgttactagccgaagattttatctctcgtagtacaaaaattctcagcgccttg
attggtgatgaattaccagcagagcaagtgaatgcgatggttgatgcggcttttcagttt
ccagcacccattaagcaagtgaaagacggcatttatgctctagagcttttccacggccca
acgctggcatttaaagattttggtggtcgctttatggcgcagtcactggccgctgtttca
aatggcggacagatcaccattttaaccgcgacttctggtgatactggcgctgcggtggct
catgccttttatggaatgcccgacatcaaggtcgtgatactttaccctaaaggtaagatc
agcccgttacaggaaaaactcttctgcactctgggcaacaatattcacactgtcgcggta
aatggtgactttgatgcttgccaagcgttagttaagcaggcttttgatgacgccaagctt
cgccaagagatcggtttaaactctgcaaattcaatcaatatcagtcgtttaatggcacaa
atttgctactactttgaggccgcatcacaattaagcaaagcgcagcgtgaaaacttagtc
atctccgtaccgagtggcaactttggcaacctaaccgctggtctgttggcaaaagcattg
ggcttaccaatcaagcgttttatcgcggcaaccaatgccaatgataccgttcctcgttac
ttagaaacgggtcaatgggatccaaaacccactgtcgcgaccacatcgaatgcgatggat
gtgagtcagccgaacaactggccgcgcatcgaagagctttgtcgcttaaagggctggggg
ctagataccttaggtaaaggtgcggtatctgatgcacaaagtgcggattcagttcgtgaa
ctttacgcgcaaggttatttgtgtgaaccgcatggtgccattgcgtatcgagttttggat
gagcagttacaagcgggagaaacggggctatttttgtgtactgcgcaccctgccaaattt
aaagaagtcgttgacgatgtgctaggtactgacattgaattaccagctcctcttgcaaaa
catgcagtgatggcgttgctttctgaagagttagacaatgattttgacgctctaaaaacg
gtgttaagacgcgttcagccttaa

DBGET integrated database retrieval system