KEGG   Vibrio anguillarum 775: VAA_04313Help
Entry
VAA_04313         CDS       T01536                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
van  Vibrio anguillarum 775
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VAA_04313
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VAA_04313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(462372..463310)
Genome map
AA seq 312 aa AA seqDB search
MNKGQIMNQLVVLGSVNADHVLQVPSFPRPGETLHGRHYQVIPGGKGANQAVAAARLKAD
IGFIACVGDDAFGINIRENFKLDGINIAGVKMQPNCPTGIAMIQVSDSGENSICISAEAN
DKLTADAIEPDLAAIGAAKYLLMQLETPIDGIIKAAQIAKQNRTNVILNPAPARDLPDTL
LECVDVITPNETEAQRLTGITVDDDHTAQLAANELHKKGIEIVLITLGVKGVWLSQNGRG
QLIAGFKVDVTDTTAAGDTFNGALVTGLLEDMPLESAIKFAHAAAAISVTRFGAQTSIPT
RVEVDAFLALHQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggacaaattatgaatcagttagtggtattaggtagtgttaacgctgaccat
gttttgcaagtgccttcatttcctcgcccgggcgagacgctgcatggtcgtcattatcaa
gttattcccggtggtaaaggggccaaccaagctgtagcggccgcgcgattaaaagcggac
atcggttttattgcctgcgtgggtgacgacgcattcggtatcaatattcgtgagaatttt
aagctcgatggtatcaacattgcgggagttaaaatgcagcccaattgtccgacgggcatt
gcgatgatccaagtctcggacagcggagaaaacagcatctgtatttcggcagaggcgaat
gacaagctgacggctgatgccattgaaccggatttagccgccattggtgcggccaaatat
ttattgatgcaactggaaacgccaatcgatggcattattaaagctgcgcaaatcgccaaa
caaaatcgtaccaatgtgattttaaacccagcgcctgcccgagatctgcctgatactctg
ctagaatgtgtcgatgtgatcacaccaaacgaaacggaagcgcagcgcttaacggggatc
acggttgatgatgatcacacggcgcagttagcggccaatgaactgcataaaaaagggatt
gaaatcgtcttgatcaccttaggtgtaaaaggcgtttggctaagccaaaatggacgtggt
caactgattgctggttttaaagtcgatgtgacagacaccaccgcggcaggtgatacgttt
aacggtgctttggtcacgggtttgttggaagatatgcctttagaatcagccattaaattt
gcacatgctgcggcagccatttctgttacccgttttggcgcgcaaacctcaatacccacc
cgagtagaagtggacgcgtttctcgctctgcatcaatag

DBGET integrated database retrieval system