KEGG   Variovorax paradoxus S110: Vapar_0137Help
Entry
Vapar_0137        CDS       T00916                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00220  Arginine biosynthesis
vap00250  Alanine, aspartate and glutamate metabolism
vap00471  D-Glutamine and D-glutamate metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Vapar_0137
   00220 Arginine biosynthesis
    Vapar_0137
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Vapar_0137
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Vapar_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACS16800
JGI: Vapar_0137
UniProt: C5CWZ6
Position
1:complement(136286..137224)
Genome map
AA seq 312 aa AA seqDB search
MKDADFQPVLDDIVTTLRPLLGTAGTVASYIPALACIDARQLGIALRTCNGAEAFAGDAE
TPFSIQSVSKLFTLTLAMQRMGDALWERIGREPSGNPFNSLVQLENEQGKPRNPFINAGA
IAVADRLVSQALQAGGSAKADILALMGSLCGEPIAFDDEVARSEAATGFRNIALANFMKS
FGKIDNDVAVVLDTYFHQCALRMSCRQLARAAAFLCRDGAHPIDGQAEVTGERQTRRINA
LMLTCGTYDAAGDVAFSIGLPCKSGVGGGIVAVVPDRLTLCVWSPALDATGNSLLGMKAL
ELFVARTGLSVF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgcggacttccagccggtgctcgacgacatcgtcaccaccctgcggccgctg
ctgggcaccgccggcacggtggccagctacatcccggcgctggcctgcatcgatgcgcgc
cagctcggcattgcgctgcgcacctgcaacggcgccgaggccttcgcgggcgatgccgaa
acgccgttctcgatccagagcgtgtccaagctcttcacgctgacgctggccatgcagcgc
atgggcgacgcgctgtgggagcgcatcggccgcgagccttcgggcaacccgttcaactcg
ctggtgcagctggagaacgagcagggcaagccgcgcaatccgttcatcaatgcgggcgcc
atcgcggtggccgaccggctcgtgagccaggcattgcaggctggcggcagcgccaaggcc
gacattcttgcgctgatggggagcctgtgcggcgagccgattgcgttcgacgacgaggtg
gcgcgctccgaggccgcgaccggctttcgcaacattgcgctcgccaacttcatgaagagc
ttcggcaagatcgacaacgatgtggccgtggtgctcgacacctactttcaccagtgcgcg
ctgcgcatgagttgccgccagctcgcacgcgcggcggccttcctgtgccgcgacggcgcg
catccgatcgacggccaggccgaggtgaccggcgagcgccagacgcggcgcatcaacgcg
ctgatgctcacctgtggcacctacgacgccgcgggcgacgtggcgttctcgatcggcctg
ccgtgcaagagcggcgtgggcggcggcatcgtggccgtggtgcctgatcggctcacgctg
tgcgtgtggtcgcccgcgctggacgcgacgggcaactcgctgctcggcatgaaggcgctc
gagctgttcgtggcgcggaccgggctgtcggtcttctga

DBGET integrated database retrieval system