KEGG   Variovorax paradoxus S110: Vapar_0187Help
Entry
Vapar_0187        CDS       T00916                                 

Definition
Nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vap  Variovorax paradoxus S110
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Vapar_0187
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Vapar_0187
    3.5.1.-  
     Vapar_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:191673..192395
Genome map
AA seq 240 aa AA seqDB search
MHDSHRRSLLKSTAALGLLGAAGTLFAAPKLKPNDKSALIVIDVQNCFVDGGTLPVKGGA
EVVPVINKLADSFENIVVTQDWHTQGHASFASAHAGQKPFSSIKLSYGNQVLWPDHCVQG
TDDAALHKDLKLPTAQVIVRKGFHKGVDSYSAFEEADRKTATGLGGYLKQRGIKTVYVAG
LATDFCVAWTALDARKAGFEVYVIEDATRAIDLNGSLAAAWKQMAAKGVKRIQSADIQAA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcacgactcgcaccgcagatcccttctgaagtccacggccgcactgggcctgctgggc
gcggccggaacgctgttcgcggctccgaagctcaagccgaacgacaagtccgcgctgatc
gtgatcgacgtgcagaactgcttcgtcgatggcggcacgctgcccgtcaagggcggcgcc
gaggtggtgccggtgatcaacaagctggccgattcgttcgagaacatcgtggtcacgcag
gactggcacacgcaaggccatgcgtcgttcgcgagcgcgcatgccgggcagaagccgttc
agcagcatcaagctctcgtacggcaaccaggtgctctggcccgaccactgcgtgcagggc
accgacgacgcggcgctgcacaaggacctgaagctgcccaccgcgcaggtcatcgtccgc
aagggcttccacaagggcgtcgacagctattccgccttcgaggaggccgaccgcaagacc
gccaccggcctgggcggctacctcaagcagcgcggcatcaagacggtctacgtggccggc
ctggccaccgacttctgcgtggcttggaccgcgctcgatgcgcgcaaggccggcttcgag
gtctacgtgatcgaggacgccacgcgcgccatcgacctcaacggctcgctcgccgccgca
tggaagcagatggcggccaagggcgtcaagcgcatccagtccgccgacatccaggcggcc
tga

DBGET integrated database retrieval system