KEGG   Variovorax paradoxus S110: Vapar_0226Help
Entry
Vapar_0226        CDS       T00916                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vap  Variovorax paradoxus S110
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Vapar_0226
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_0226
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Vapar_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(243150..243641)
Genome map
AA seq 163 aa AA seqDB search
MTTSIYDFEANRIDGKKVKLSDFRGKVLLIVNTASQCGFTPQFAGLEQLHEKYASQGLVV
LGFPSNQFGSQDPGTNEEIGAFCTTNYGVSFPMMEKIDVNGGNAAPLYQWLTKEKPGLLG
STAIKWNFTKFLVGRDGRVRKRYAPLDTPASIAREIEAALAAG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcatctacgacttcgaagccaaccggatcgacggcaagaaggtgaagctc
tcggacttccgcggcaaggtgctgctgatcgtcaacacggccagccagtgcggcttcacg
ccgcagttcgccgggctcgagcagctgcacgagaagtacgcgagccaggggctggtggtg
ctgggctttccgtcgaaccagttcggctcgcaggacccaggcaccaacgaggaaatcggc
gccttctgcaccaccaactacggcgtgagttttccgatgatggaaaagatcgacgtcaac
ggcggcaacgccgcgccgctctaccagtggctcaccaaggaaaagccgggcctcctgggc
agcacggccatcaagtggaacttcaccaagttcctggtcggccgcgacgggcgggtgcgc
aagcgctacgcgccgctggacacgcccgcgtcaatcgcgcgcgagatcgaggcggcgctg
gcggcgggctga

DBGET integrated database retrieval system