KEGG   Variovorax paradoxus S110: Vapar_0226Help
Entry
Vapar_0226        CDS       T00916                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vap  Variovorax paradoxus S110
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:vap00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:vap00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(243150..243641)
Genome map
AA seq 163 aa AA seqDB search
MTTSIYDFEANRIDGKKVKLSDFRGKVLLIVNTASQCGFTPQFAGLEQLHEKYASQGLVV
LGFPSNQFGSQDPGTNEEIGAFCTTNYGVSFPMMEKIDVNGGNAAPLYQWLTKEKPGLLG
STAIKWNFTKFLVGRDGRVRKRYAPLDTPASIAREIEAALAAG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcatctacgacttcgaagccaaccggatcgacggcaagaaggtgaagctc
tcggacttccgcggcaaggtgctgctgatcgtcaacacggccagccagtgcggcttcacg
ccgcagttcgccgggctcgagcagctgcacgagaagtacgcgagccaggggctggtggtg
ctgggctttccgtcgaaccagttcggctcgcaggacccaggcaccaacgaggaaatcggc
gccttctgcaccaccaactacggcgtgagttttccgatgatggaaaagatcgacgtcaac
ggcggcaacgccgcgccgctctaccagtggctcaccaaggaaaagccgggcctcctgggc
agcacggccatcaagtggaacttcaccaagttcctggtcggccgcgacgggcgggtgcgc
aagcgctacgcgccgctggacacgcccgcgtcaatcgcgcgcgagatcgaggcggcgctg
gcggcgggctga

DBGET integrated database retrieval system