KEGG   Variovorax paradoxus S110: Vapar_0415Help
Entry
Vapar_0415        CDS       T00916                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vap  Variovorax paradoxus S110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Vapar_0415
Enzymes [BR:vap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Vapar_0415
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vapar_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(450146..452317)
Genome map
AA seq 723 aa AA seqDB search
MPSLLLPEREVHALMRAEHGDPFAVLGPHETRDGLLVRALLPGAQSVAVVHTRTGWPLAL
LSRQEGSDLFAGLVPAAEALLGYSFQVDWGTHSSRLEDPYRFAFVLGATDVWLLAEGTHL
RPWERLGAHLCEMDGVKGVAFAVWAPNARRVSVVGDFNNWDGRRHMMRLRRECGVWEIFA
PQLATGDSYEFEILSAQGEVLRKADPFAFSSRLRPETACVVAPLPAPVAMPPERAAANGR
HAPMSIYEVHLGSWRRKNGHEWLDYRELADTLVPYARDMGFTHIELLPVSEHPFDGSWGY
QPIGLYAPTSRFGTPGDFRHLVEAAHAAGLGVILDWVPAHFPTDAHGLGRFDGTALYEYA
DPREGFHNDWKTFIFNYGRTEVRNYLVGNALYWLERYGVDGLRVDAVASMLYRDYSRQPG
EWVPNIHGGRENLEAIDFLRRMNRVVGVERPGAITLAEESTSFPGVTRPPEDGGLGFHYK
WNMGWMNDTLAYAGIDPVHRKHHHQKITFGLMYAHSENFVLPLSHDEVVHGKGSMFGRMP
GDEWQKFAGLRNLYGYLWAYPGKKLLFMGNEFAQVAEWNADRSLDWHLLEQAPHQGMRRL
VRDLNNVYRHFPALHELDTERAGFEWLVHDDREQSVFAFVRRAQGGSFVVAVCNFTPLPR
HGYRLGVPAAGAYREAINTDGAVYGGSGVGNGVVDSEPVPWHGRADSILISVPPLATVMW
VLA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccttccctgctgctgcccgaacgcgaagtgcacgcgctgatgcgcgccgagcacggc
gatccgttcgcggtgctcggtccgcacgagacgcgcgacggcctgctggtgcgcgcgctg
ctgccgggcgcgcagagcgtggccgtggtgcacacgcgcacgggctggccgctggcgctg
ctgtcgcggcaggaaggctccgatctttttgccggactggtgcccgcggccgaggcgctg
ctgggctattcgttccaggtcgactggggcacgcacagctcgcggctcgaagacccgtac
cgctttgcgttcgtgctgggtgccaccgacgtatggctgctggccgagggcacgcacctg
cgaccctgggagcggctgggcgcacacctgtgcgagatggatggcgtcaagggcgtggcc
ttcgcggtctgggcgcccaatgcgcggcgcgtctcggtggtcggcgacttcaacaactgg
gacggccggcgccacatgatgcggctgcgccgcgaatgcggcgtgtgggaaatcttcgcg
ccgcagctggccacgggcgacagctacgaattcgagatcctctcggcccagggcgaggtg
ctgcgcaaggccgatcccttcgccttctcctcgcgcctgcggcccgagaccgcctgcgtg
gtcgcgccgctgcccgcgcccgtcgccatgccgcccgaacgcgccgccgccaacggccgc
catgcgccgatgagcatctacgaggtgcacctgggctcctggcgccgcaagaacggccat
gaatggctggactaccgcgagctggccgacacactggtgccgtacgcgcgcgacatgggc
ttcacgcacatcgagctgctgccggtcagcgagcatccgttcgacggctcctggggctac
cagccgatcggcctgtatgcgcccacctcgcgcttcggcacgcccggcgacttccgccat
ctggtcgaagccgcgcatgccgcgggcctgggcgtgatcctcgactgggtgcccgcgcac
ttccccaccgacgcgcacggcctgggccgcttcgacggcaccgcgctctatgaatacgcc
gatccgcgcgagggcttccacaacgactggaagaccttcatcttcaactacggccgcacc
gaggtgcgcaactacctggtcggcaatgcgctgtactggctcgagcgctacggcgtcgac
ggactgcgcgtcgacgccgtggcctccatgctctaccgcgactacagccgccagcccggc
gaatgggtgcccaacatccacggcgggcgcgagaatctcgaggccatcgacttcctgcgg
cgcatgaaccgggtggtgggcgtcgagcgcccgggcgccatcacgctggccgaggagtcc
acgagctttccgggcgtgacgcggccgcccgaggacggcggcctgggcttccactacaaa
tggaacatgggctggatgaacgacacgctcgcctatgcgggcatcgacccggtccaccgc
aagcaccaccaccagaagatcaccttcggcctgatgtatgcgcacagcgagaacttcgtg
ctgccgctctcgcacgacgaggtggtgcacggcaagggctcgatgttcggccgcatgccc
ggcgacgagtggcagaagttcgcggggctgcgcaatctttatggctacctctgggcctat
ccgggcaagaagctgctgttcatgggcaatgaattcgcccaggtggcggaatggaacgcc
gaccgcagcctcgactggcacctgctcgagcaggcgccgcaccagggcatgcggcggctg
gtgcgcgacctcaacaacgtgtaccggcacttccccgcgctgcacgagctcgacaccgaa
agggccggcttcgagtggctggtgcatgacgaccgggagcagtcggtcttcgccttcgtg
cgccgggcccagggcggctccttcgtggtggcggtgtgcaacttcacgccgctgccgcgc
cacggctaccggcttggcgtgcccgcggcgggcgcctaccgcgaggccatcaacaccgac
ggcgccgtgtacggcggcagcggtgtcggcaacggcgtggtcgacagcgaaccggtgccc
tggcacggccgggccgattcgattctcatcagcgtgccgcccctggccaccgtgatgtgg
gtgctggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system