KEGG   Variovorax paradoxus S110: Vapar_0440Help
Entry
Vapar_0440        CDS       T00916                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_0440
   01230 Biosynthesis of amino acids
    Vapar_0440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_0440
   00030 Pentose phosphate pathway
    Vapar_0440
   00051 Fructose and mannose metabolism
    Vapar_0440
   00052 Galactose metabolism
    Vapar_0440
  Energy metabolism
   00680 Methane metabolism
    Vapar_0440
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Vapar_0440
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Vapar_0440
Protein phosphatases and associated proteins [BR:vap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Vapar_0440
Messenger RNA biogenesis [BR:vap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Vapar_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(481742..483007)
Genome map
AA seq 421 aa AA seqDB search
MSNTTLTNAFYAQSGGVTSVINASACGVIETARKHPDRIGNVYAGRNGIIGALTEELIDT
GAEPAEAIAALRSTPSGAFGSCRYKLKSLEKNRREYERLIEVFKAHGIGYFFYNGGGDSA
DTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVAKYVAVSTLEASFDVRSM
AATSTKVFVLEVMGRHAGWIAAAGGLVADHGIPVVVLFPEIEFDKARFLARVDALVKQHG
YCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQMVKEALGHKFHWAVADYLQ
RAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERTSDAPYTYRIGSAPLDAVANV
EKPMPRDFISDDGWGITDKCRLYLLPLIEGEDYPAYRNGLPVYATLRNVAVPRKLPAFEL
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccaccttgaccaacgccttctacgcccagtcgggcggcgtcacctcggtc
atcaatgcgtcggcctgcggcgtgatcgagacggcacgaaaacacccggaccgcatcggc
aatgtctacgccgggcgcaacggcatcatcggcgcgctgaccgaagagctcatcgacacc
ggcgccgagccggccgaggcgattgcggcgctgcgcagcacgccctcgggcgccttcggc
tcgtgccgctacaagctcaagtcgctcgagaagaaccggcgcgagtacgagcggctgatc
gaggtgttcaaggcgcacggcatcggctatttcttctacaacggcggcggcgattcggcc
gacacctgcttcaaggtgagccagctgtcgcagtcgctcggctatccgctgcaggccatc
cacgttcccaagaccatcgacaacgacctgccgctgaccgactgctgcccgggcttcggc
tcggtggccaagtacgtggcggtgtcgacgctggaagcctcgttcgacgtgcgctcgatg
gccgccacctccaccaaggtgttcgtgctcgaggtgatggggcgccatgcgggctggatc
gcggcggccggcgggctcgtggccgaccatggcattccggtggtggtgctgttccccgag
atcgaattcgacaaggcgcgctttctcgcgcgcgtggatgcgctggtgaagcagcacggc
tactgctcggtggtggtgtccgagggctgccactaccctgacggaaccttcctggccgag
cagggcacgcgcgacgccttcggccatgcgcagctcggcggcgcggcgccggtggtggcg
cagatggtcaaggaggcgctgggccacaagttccactgggcggtggccgactacctgcag
cgcgcagcgcggcacattgcctcggccaccgacgtgaagcaggcctacgaactgggccag
cgcgcggtcgagctcgcgctcgaaggccgcaacgcggtgatgccgaccatcgagcgcact
tcggatgcgccctacacctaccgcatcggcagcgcgccgctcgatgcggtggcgaatgtc
gaaaagccgatgccgcgcgacttcatctcggacgacggctggggcatcaccgacaagtgc
aggctctacctgctgccgctgatcgaaggcgaggactaccccgcctaccgcaacggcctg
ccggtgtacgcaaccctgcgcaacgtggccgtgcccaggaagctgccggccttcgagctc
gcctga

DBGET integrated database retrieval system