KEGG   Variovorax paradoxus S110: Vapar_0440Help
Entry
Vapar_0440        CDS       T00916                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00030  Pentose phosphate pathway
vap00051  Fructose and mannose metabolism
vap00052  Galactose metabolism
vap00680  Methane metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_0440
   00030 Pentose phosphate pathway
    Vapar_0440
   00051 Fructose and mannose metabolism
    Vapar_0440
   00052 Galactose metabolism
    Vapar_0440
  Energy metabolism
   00680 Methane metabolism
    Vapar_0440
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Vapar_0440
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Vapar_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACS17103
JGI: Vapar_0440
UniProt: C5CJA3
Position
1:complement(481742..483007)
Genome map
AA seq 421 aa AA seqDB search
MSNTTLTNAFYAQSGGVTSVINASACGVIETARKHPDRIGNVYAGRNGIIGALTEELIDT
GAEPAEAIAALRSTPSGAFGSCRYKLKSLEKNRREYERLIEVFKAHGIGYFFYNGGGDSA
DTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVAKYVAVSTLEASFDVRSM
AATSTKVFVLEVMGRHAGWIAAAGGLVADHGIPVVVLFPEIEFDKARFLARVDALVKQHG
YCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQMVKEALGHKFHWAVADYLQ
RAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERTSDAPYTYRIGSAPLDAVANV
EKPMPRDFISDDGWGITDKCRLYLLPLIEGEDYPAYRNGLPVYATLRNVAVPRKLPAFEL
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccaccttgaccaacgccttctacgcccagtcgggcggcgtcacctcggtc
atcaatgcgtcggcctgcggcgtgatcgagacggcacgaaaacacccggaccgcatcggc
aatgtctacgccgggcgcaacggcatcatcggcgcgctgaccgaagagctcatcgacacc
ggcgccgagccggccgaggcgattgcggcgctgcgcagcacgccctcgggcgccttcggc
tcgtgccgctacaagctcaagtcgctcgagaagaaccggcgcgagtacgagcggctgatc
gaggtgttcaaggcgcacggcatcggctatttcttctacaacggcggcggcgattcggcc
gacacctgcttcaaggtgagccagctgtcgcagtcgctcggctatccgctgcaggccatc
cacgttcccaagaccatcgacaacgacctgccgctgaccgactgctgcccgggcttcggc
tcggtggccaagtacgtggcggtgtcgacgctggaagcctcgttcgacgtgcgctcgatg
gccgccacctccaccaaggtgttcgtgctcgaggtgatggggcgccatgcgggctggatc
gcggcggccggcgggctcgtggccgaccatggcattccggtggtggtgctgttccccgag
atcgaattcgacaaggcgcgctttctcgcgcgcgtggatgcgctggtgaagcagcacggc
tactgctcggtggtggtgtccgagggctgccactaccctgacggaaccttcctggccgag
cagggcacgcgcgacgccttcggccatgcgcagctcggcggcgcggcgccggtggtggcg
cagatggtcaaggaggcgctgggccacaagttccactgggcggtggccgactacctgcag
cgcgcagcgcggcacattgcctcggccaccgacgtgaagcaggcctacgaactgggccag
cgcgcggtcgagctcgcgctcgaaggccgcaacgcggtgatgccgaccatcgagcgcact
tcggatgcgccctacacctaccgcatcggcagcgcgccgctcgatgcggtggcgaatgtc
gaaaagccgatgccgcgcgacttcatctcggacgacggctggggcatcaccgacaagtgc
aggctctacctgctgccgctgatcgaaggcgaggactaccccgcctaccgcaacggcctg
ccggtgtacgcaaccctgcgcaacgtggccgtgcccaggaagctgccggccttcgagctc
gcctga

DBGET integrated database retrieval system