KEGG   Variovorax paradoxus S110: Vapar_0452Help
Entry
Vapar_0452        CDS       T00916                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vap  Variovorax paradoxus S110
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_0452
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vapar_0452
   00630 Glyoxylate and dicarboxylate metabolism
    Vapar_0452
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Vapar_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(493188..495362)
Genome map
AA seq 724 aa AA seqDB search
MTARTTTHGLQVATELHRFIEDKVLPASGVASDVFWKGFDAIVHDLAPKNIALLAERDRL
QAELDAWHKKNPGPIADMPAYRAFLEKIGYLLPQPKGAKATTANVDSELALQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGYNPVRGAKVIEFARNVLDQAA
PLENGSHKMATGYSVKDGKLVVALQSSSTGLADPAQFVGYQGDAAAPSSVLLKHNGIHLD
IRIDRSTPIGKGDAAGVSDLVLEAALSTILDLEDSVAVVDAADKVVAYSNWLGIVEGTLT
EEVAKGGKTFTRGLNPDREYTGADGRPVKLHGRSLMFLRNVGHLMTNPAVLYAGGKEIPE
GILDAVVTTTIAMIDLKRKGNSRTGSIYIVKPKMHGPAEVAFASELFGRVEQLLGLPANT
VKLGIMDEERRTSVNLKACIAEAAARVAFINTGFLDRTGDEMHTAMHGGPMIRKGDMKSS
AWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSPT
AATLHALHYHQVSVTAVQQELEKIDADAERDNILNALLQVPIAPAANWTEAEKQQEIDNN
VQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLLHGVVTKAQVDET
FQRMAKVVDEQNAGDPVYQPMAGHFDTSAAYKAAQDLVFKGIEQPSGYTEPLLHAWRLKV
KGEV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcaccaccacccacggcctccaggttgcgaccgagcttcatcgcttcatc
gaagacaaggtcctgcccgccagcggcgtggccagcgatgttttctggaagggcttcgac
gccatcgtccatgacctcgcaccgaagaacatcgcgctcttggccgaacgcgaccgcctg
caggccgagctcgacgcctggcacaagaagaaccccggcccaatcgccgacatgccggcc
taccgcgccttcctcgagaagatcggctacctgctgccgcagcccaagggcgcgaaggcc
accaccgcgaacgtcgattccgagctcgcgctgcaggccggcccgcaattggtggtgccg
atcctcaacgcacgctacgcgctcaacgccgccaacgcgcgctggggttcgctgtacgac
gcgctgtacggcaccgatgccattcccgaaaccggcggtgccgaaaagggcaagggctac
aaccccgtgcgcggcgccaaggtcatcgagttcgcgcgcaacgtgctcgaccaggccgcg
ccgctcgaaaacggctcgcacaagatggcgaccggctacagcgtgaaggacggcaagctc
gtggtcgcgctgcaaagcagcagcaccggcctcgccgatcccgcgcagttcgtcggctac
cagggcgatgcggccgcgccgtcgtcggtgctgctcaagcacaacggcatccacctggac
atccgcatcgaccgcagcacgccgatcggcaagggcgacgcggccggtgtgagcgacctg
gtgctcgaagccgcgctctcgaccatcctcgatctggaagactcggtggccgtggtcgat
gcggccgacaaggtggtcgcctattcgaactggctcggcatcgtcgagggcacgctcacc
gaagaagtcgccaagggcggcaagaccttcacgcgcggcctcaaccccgaccgcgaatac
accggcgccgacggccgccccgtgaagctgcacggccgctcgctgatgttcctgcgcaac
gtgggccacctgatgaccaacccggccgtgctgtatgcaggcggcaaggaaattcccgaa
ggcatcctcgatgccgtggtcaccaccaccatcgcgatgatcgacctgaagcgcaagggc
aactcgcgcaccggcagcatctacatcgtcaagcccaagatgcacggcccggccgaagtg
gcctttgccagcgagctgttcggccgcgtcgagcaactgctcggcctgcccgccaacacc
gtgaagctcggcatcatggacgaggagcgccgcaccagcgtgaacctcaaggcctgcatc
gccgaggccgccgcgcgcgtggccttcatcaacaccggttttctcgaccgcaccggcgac
gagatgcacactgccatgcacggcggcccgatgatccgcaagggcgacatgaagtccagc
gcgtggatcggcgcctacgagaagaacaacgtgctggtcggcctctcgtgcggcctgcgc
ggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatggccgccatgctc
gagcagaagatcgcgcaccccaaggccggcgccaacaccgcctgggtgccctcgcccacc
gcggccacgctgcatgcgctgcactaccaccaggtgagcgtcacggccgtgcagcaggag
ctcgagaagatcgacgccgacgcggaacgcgacaacatcctcaatgcgctgctgcaggtg
cccatcgcccccgcggccaactggaccgaggccgagaagcagcaggagatcgacaacaac
gtgcagggcatcctcggctacgtggtgcgctggatcgaccagggcgtgggctgctccaag
gtgcccgacatccacaacgtgggcctgatggaggaccgcgccacactgcgcatctcgagc
cagcacatcgccaactggctgctgcacggcgtggtgaccaaggcgcaggtcgacgagacc
ttccagcgcatggccaaggtggtcgacgagcagaacgccggcgacccggtgtaccagccg
atggccggccacttcgacacctcggctgcgtacaaggccgcgcaggacctggtgttcaag
ggcatcgagcagccgagcgggtataccgagccgctgctgcatgcgtggcggctgaaggtg
aagggcgaagtctga

DBGET integrated database retrieval system