KEGG   Variovorax paradoxus S110: Vapar_0719Help
Entry
Vapar_0719        CDS       T00916                                 

Definition
(GenBank) Phospholipase A(2)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00564  Glycerophospholipid metabolism
vap00565  Ether lipid metabolism
vap00590  Arachidonic acid metabolism
vap00592  alpha-Linolenic acid metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Vapar_0719
   00565 Ether lipid metabolism
    Vapar_0719
   00590 Arachidonic acid metabolism
    Vapar_0719
   00591 Linoleic acid metabolism
    Vapar_0719
   00592 alpha-Linolenic acid metabolism
    Vapar_0719
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Vapar_0719
    3.1.1.32  phospholipase A1
     Vapar_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACS17373
JGI: Vapar_0719
UniProt: C5CLH8
Position
1:complement(787062..788240)
Genome map
AA seq 392 aa AA seqDB search
MTQRTHAIFSVSRLAALAACLGGTAAAHAQATDQPRSPLADAQLTWQQCAALGNSNEARL
ACFDRWAQQQTLPSVSVPVAPPVLASTQPAPPVDASIPATRVISVGASEGCRDRQYSALS
RFWELENGTDCGTFGFRGYRPLNVSASAATSRPDTPTSPSEGHTGTPVAYQANEMRIGLS
VRTKIAQGLLTQNEPAKKDSLWFAYSQQSTWQLFNGSISRPFRTTDHEPELMYVYPLDFA
LPGGWRWRYAGVGVVHQSNGQSLPLSRSWNRVYLMGGAELGDRFTITGRIWQRMSEEAAK
DDNPDISNYIGRAELTGRWNFNRDNTLGLTVRNNLRDSGRGSVRLEWLKAIGDPATSNLR
FHTQLFHGYGDTLVDYNRKRTVLSIGLSLVDF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacgaacacacgccatcttctccgtctcccggctggcggccctcgcggcctgc
cttggcggcaccgccgccgcgcatgcgcaggccacggaccagccgcgcagcccgctggcc
gacgcgcagctgacgtggcagcaatgcgccgcgctcggcaacagcaacgaagcgcgcctg
gcctgcttcgaccgctgggcgcagcagcagacgctgccttcggtctcggtgcccgtggcg
ccgccggtgctggccagcacgcagccggcgccgccggtggacgcctcgataccggccacg
cgcgtgatctcggtcggcgccagcgaaggctgccgcgaccgtcagtactcggcgctgtcg
cgcttctgggaactggagaacggcaccgactgcggcaccttcggcttccgcggctaccgc
ccgctcaacgtgtcggcctcggccgccaccagccggcccgacacgcccacctcgccctcg
gaaggccacaccggcacgcccgtggcctaccaggccaacgagatgcgcatcggcctgtcg
gtgcgcaccaagatcgcccagggcctgctcacgcagaacgagccggccaagaaggactcg
ctgtggttcgcgtattcgcagcagtcgacctggcagctgttcaacggctcgatctcgcgg
ccgttccgcaccaccgaccacgagcccgagctgatgtatgtctatccgctggacttcgcc
ctgcccggcggctggcgctggcgctatgcgggcgtgggcgtggtgcaccagtcgaacggc
cagagcctgccgctgtcgcgcagctggaaccgcgtctacctgatgggcggcgccgagctg
ggcgaccgcttcaccatcaccgggcgcatctggcagcgcatgtcggaagaggccgcgaag
gacgacaaccccgacatctccaactacatcggccgtgccgaactcacgggccgctggaac
ttcaaccgcgacaacacgctgggcctcacggtgcgcaacaacctgcgcgacagcggccgc
ggttcggtgcggctcgaatggctcaaggccatcggcgatccggccacgagcaacctgcgc
ttccatacgcagctgttccacggctacggcgacacgctggtcgactacaaccgcaagcgc
accgtgctcagcatcggcctgagcctggtggacttctga

DBGET integrated database retrieval system