KEGG   Variovorax paradoxus S110: Vapar_0982Help
Entry
Vapar_0982        CDS       T00916                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_0982
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_0982
   00052 Galactose metabolism
    Vapar_0982
   00500 Starch and sucrose metabolism
    Vapar_0982
   00520 Amino sugar and nucleotide sugar metabolism
    Vapar_0982
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Vapar_0982
   00524 Butirosin and neomycin biosynthesis
    Vapar_0982
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Vapar_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1079578..1080504
Genome map
AA seq 308 aa AA seqDB search
MRACVDIGGTKVAVSLSPSSDAPLAGRRSEPTAKTGDNDAVAVQIMRMIDEVCAEQGIAP
ADIDRVGVSSTGPFELRDGMVELATPNICGGIAGPARGLPNNWMTAIIEAPLARRFGRVR
VENDAVAALEAERHWGALQGLDHCAYVTWSTGVGVGLCVDGRALRGKNGNAGHAGHSFVV
DDASGALCGCGNLGDVEALVAGNSIARRFGQPAPDLFAAASDGEPHAVEIVDALCRVMGR
MIYNLIATLDLQRISLGGSVFWHHRDFLLPRLQAQVDGKLKPLTRGVLLVPAGLGEKVGD
YAALALLD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctgcgttgacatcggcggcaccaaggtggccgtgagcctttccccttcgagc
gatgcgccgctggccggccgccgcagcgagccgacggccaagaccggcgacaacgacgcc
gtggcggtgcagatcatgcgcatgatcgacgaggtctgcgccgagcagggcatcgcgccg
gccgacatcgaccgcgtgggcgtctcgtccaccggccccttcgagctgcgcgacggcatg
gtggagctggccacgcccaacatctgcggcggcattgcggggccggcgcgcggcctgccc
aacaactggatgacggcaatcatcgaagccccgctggcccggcgcttcggccgcgtgcgg
gtcgagaacgacgccgtggccgcgctcgaggccgagcgccactggggcgcgctgcagggc
ctggaccactgcgcctacgtcacctggagcaccggcgtgggcgtgggcctgtgcgtggac
ggccgtgcgctgcgtggcaagaacggcaatgccggccatgcgggccacagcttcgtggtg
gacgacgccagcggtgcgctctgcggctgcggcaacctcggcgacgtggaggcgctggtg
gcgggcaactccatcgcgcgccgcttcgggcagcccgcgcccgacctgttcgcggccgcc
tcggacggcgagccgcacgccgtcgagatcgtcgatgcgctgtgccgcgtgatgggccgc
atgatctacaacctgattgccacgctcgatctccagcgcatcagcctgggcggcagcgtg
ttctggcaccaccgcgacttcctgctgccgcggctgcaggcgcaggtcgacggcaagctc
aagccgctcacgcgcggcgtgctgctggtgcccgcggggcttggcgaaaaggtcggcgac
tacgccgccctggcactgctcgactga

DBGET integrated database retrieval system