KEGG   Variovorax paradoxus S110: Vapar_1039Help
Entry
Vapar_1039        CDS       T00916                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_1039
   00052 Galactose metabolism
    Vapar_1039
Enzymes [BR:vap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Vapar_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1136734..1137807
Genome map
AA seq 357 aa AA seqDB search
MSSNITTREFGRMPDGRIVTEYTLDNGLGLRLGAINHGGIVTALHVPDRHGHSGNIVLGL
PSLADYLGPHPHLGTIVGRYANRIAGGRFTLDGAQHQLPLNNGANSLHGGHRGFGTRFWQ
IEPVPADGAAGEEIAIELRYTSADGEEGFPGEVQLTVRYALSTRENTWRIDYRAVTDRPT
VLNLSHHDYFNLAGEGAVLDHRLIIPASRYCPVDAGLIPLGLAPVAGTPFDFRAATPVGE
RIDAPHEQLRVAGGYDHNWVLDREPAGLALAARLEHPPSGRVMEVHTTEPAVQFYSGNFL
DGSLRGADGESLRRGAGLCLETQHYPDSPNQPDFPSTVLRPGEVFNSSTLHRFGTLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacatcaccacccgcgaattcggccgcatgcccgacggccgcatcgtgacc
gaatacaccctggacaacggcctgggcctgcgcctgggtgccatcaaccatggcggcatc
gtcaccgcattgcacgtgcccgaccggcatgggcacagcggcaacatcgtgctcggcctg
ccgagccttgcggactacctgggcccgcatccgcacctgggcaccatcgtcgggcgctat
gcgaaccggatcgcgggtgggcgcttcacgctcgatggcgcccagcaccagctcccgctg
aacaacggcgccaactcgctgcacggcgggcaccggggcttcggcacgcgcttctggcag
atcgagccggtgccggcggacggcgcggcgggcgaggaaatcgccatcgagcttcgctac
accagcgccgatggcgaagaaggctttccgggcgaagtgcaactgacggtgcgctacgcg
ctcagcacccgcgagaacacctggcgcatcgactaccgcgccgtgaccgaccggcccacg
gtgctgaacctgagccaccacgactacttcaacctggcgggcgagggcgcggtgctggac
catcggctcatcattcccgcgagccgctactgccccgtggatgcaggcctgattccgctc
ggccttgcgccggtggccggaacgccattcgacttccgcgcggccacgccggtcggcgag
cgcatcgatgcgccgcacgagcaattgcgcgtcgccggcggctacgaccacaactgggtg
ctcgaccgcgagcccgccggcctggcgctggcggcgcggctcgagcacccgccgtcaggg
cgcgtgatggaggtgcacacgaccgagccggcggtgcagttctattcgggcaacttcctc
gacggcagcctgcgcggcgccgatggcgagagcttgcggcgcggcgccgggttgtgcctg
gaaacgcagcactatcccgattcgccgaaccagccggactttccttcgacggtgctgcgg
ccgggcgaagtgttcaacagcagcacgctgcaccgcttcggcacactggcctag

DBGET integrated database retrieval system