KEGG   Variovorax paradoxus S110: Vapar_1039Help
Entry
Vapar_1039        CDS       T00916                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00052  Galactose metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_1039
   00052 Galactose metabolism
    Vapar_1039
Enzymes [BR:vap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Vapar_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACS17690
JGI: Vapar_1039
UniProt: C5CPG9
Position
1:1136734..1137807
Genome map
AA seq 357 aa AA seqDB search
MSSNITTREFGRMPDGRIVTEYTLDNGLGLRLGAINHGGIVTALHVPDRHGHSGNIVLGL
PSLADYLGPHPHLGTIVGRYANRIAGGRFTLDGAQHQLPLNNGANSLHGGHRGFGTRFWQ
IEPVPADGAAGEEIAIELRYTSADGEEGFPGEVQLTVRYALSTRENTWRIDYRAVTDRPT
VLNLSHHDYFNLAGEGAVLDHRLIIPASRYCPVDAGLIPLGLAPVAGTPFDFRAATPVGE
RIDAPHEQLRVAGGYDHNWVLDREPAGLALAARLEHPPSGRVMEVHTTEPAVQFYSGNFL
DGSLRGADGESLRRGAGLCLETQHYPDSPNQPDFPSTVLRPGEVFNSSTLHRFGTLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacatcaccacccgcgaattcggccgcatgcccgacggccgcatcgtgacc
gaatacaccctggacaacggcctgggcctgcgcctgggtgccatcaaccatggcggcatc
gtcaccgcattgcacgtgcccgaccggcatgggcacagcggcaacatcgtgctcggcctg
ccgagccttgcggactacctgggcccgcatccgcacctgggcaccatcgtcgggcgctat
gcgaaccggatcgcgggtgggcgcttcacgctcgatggcgcccagcaccagctcccgctg
aacaacggcgccaactcgctgcacggcgggcaccggggcttcggcacgcgcttctggcag
atcgagccggtgccggcggacggcgcggcgggcgaggaaatcgccatcgagcttcgctac
accagcgccgatggcgaagaaggctttccgggcgaagtgcaactgacggtgcgctacgcg
ctcagcacccgcgagaacacctggcgcatcgactaccgcgccgtgaccgaccggcccacg
gtgctgaacctgagccaccacgactacttcaacctggcgggcgagggcgcggtgctggac
catcggctcatcattcccgcgagccgctactgccccgtggatgcaggcctgattccgctc
ggccttgcgccggtggccggaacgccattcgacttccgcgcggccacgccggtcggcgag
cgcatcgatgcgccgcacgagcaattgcgcgtcgccggcggctacgaccacaactgggtg
ctcgaccgcgagcccgccggcctggcgctggcggcgcggctcgagcacccgccgtcaggg
cgcgtgatggaggtgcacacgaccgagccggcggtgcagttctattcgggcaacttcctc
gacggcagcctgcgcggcgccgatggcgagagcttgcggcgcggcgccgggttgtgcctg
gaaacgcagcactatcccgattcgccgaaccagccggactttccttcgacggtgctgcgg
ccgggcgaagtgttcaacagcagcacgctgcaccgcttcggcacactggcctag

DBGET integrated database retrieval system