KEGG   Variovorax paradoxus S110: Vapar_1039Help
Entry
Vapar_1039        CDS       T00916                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vap00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vap00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1136734..1137807
Genome map
AA seq 357 aa AA seqDB search
MSSNITTREFGRMPDGRIVTEYTLDNGLGLRLGAINHGGIVTALHVPDRHGHSGNIVLGL
PSLADYLGPHPHLGTIVGRYANRIAGGRFTLDGAQHQLPLNNGANSLHGGHRGFGTRFWQ
IEPVPADGAAGEEIAIELRYTSADGEEGFPGEVQLTVRYALSTRENTWRIDYRAVTDRPT
VLNLSHHDYFNLAGEGAVLDHRLIIPASRYCPVDAGLIPLGLAPVAGTPFDFRAATPVGE
RIDAPHEQLRVAGGYDHNWVLDREPAGLALAARLEHPPSGRVMEVHTTEPAVQFYSGNFL
DGSLRGADGESLRRGAGLCLETQHYPDSPNQPDFPSTVLRPGEVFNSSTLHRFGTLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacatcaccacccgcgaattcggccgcatgcccgacggccgcatcgtgacc
gaatacaccctggacaacggcctgggcctgcgcctgggtgccatcaaccatggcggcatc
gtcaccgcattgcacgtgcccgaccggcatgggcacagcggcaacatcgtgctcggcctg
ccgagccttgcggactacctgggcccgcatccgcacctgggcaccatcgtcgggcgctat
gcgaaccggatcgcgggtgggcgcttcacgctcgatggcgcccagcaccagctcccgctg
aacaacggcgccaactcgctgcacggcgggcaccggggcttcggcacgcgcttctggcag
atcgagccggtgccggcggacggcgcggcgggcgaggaaatcgccatcgagcttcgctac
accagcgccgatggcgaagaaggctttccgggcgaagtgcaactgacggtgcgctacgcg
ctcagcacccgcgagaacacctggcgcatcgactaccgcgccgtgaccgaccggcccacg
gtgctgaacctgagccaccacgactacttcaacctggcgggcgagggcgcggtgctggac
catcggctcatcattcccgcgagccgctactgccccgtggatgcaggcctgattccgctc
ggccttgcgccggtggccggaacgccattcgacttccgcgcggccacgccggtcggcgag
cgcatcgatgcgccgcacgagcaattgcgcgtcgccggcggctacgaccacaactgggtg
ctcgaccgcgagcccgccggcctggcgctggcggcgcggctcgagcacccgccgtcaggg
cgcgtgatggaggtgcacacgaccgagccggcggtgcagttctattcgggcaacttcctc
gacggcagcctgcgcggcgccgatggcgagagcttgcggcgcggcgccgggttgtgcctg
gaaacgcagcactatcccgattcgccgaaccagccggactttccttcgacggtgctgcgg
ccgggcgaagtgttcaacagcagcacgctgcaccgcttcggcacactggcctag

DBGET integrated database retrieval system