KEGG   Variovorax paradoxus S110: Vapar_1163Help
Entry
Vapar_1163        CDS       T00916                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vap  Variovorax paradoxus S110
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vap00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1277714..1279003
Genome map
AA seq 429 aa AA seqDB search
MDKLLIRGGRQLRGEVLISGAKNAALPELCAALLTDQPVTLHNVPRLQDVSTMLKLVRNM
GVAAERDDNGTVRLDAGDLSIPEAPYELVKTMRASVLALGPLLARFGHAKVSLPGGCAIG
SRPVDQHIKGLQAMGAEIVVEHGYMIASLPAGRTRLKGARILTDMVTVTGTENFLMAAAL
AEGETLLENAAQEPEIVDLAEMLIRMGARIEGHGTSHIRIQGVEKLHGCEHAVVADRIEA
GTFLCAVAATGGDVFLRHARADHMDAVIDKLRDAGCTVAAQEGGVRISSSAPACEHLKAQ
SFSTTEYPGFPTDMQAQFMALNVIARGASMVTETIFENRFMHVNEMVRLGATIHVEGKVA
MVEGVQQLSGATVMATDLRASASLVIAGLVADGETLVDRIYHLDRGYDRMEAKLRGLGAD
IERISGAAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttctgattcgcggcgggcgccagctccgcggcgaggtactcatttccggc
gccaagaacgcagccctgccggaactgtgcgccgcgctcttgaccgaccagcccgtgacg
ctgcacaacgtgccgcgcctgcaggacgtgtcgaccatgctcaagctggtgcgcaacatg
ggcgttgcggccgagcgcgacgacaacggcacggtgcggctcgatgcgggcgacctcagc
atccccgaggcaccctacgaactggtgaagaccatgcgtgcctccgtgctggcgctgggc
ccgctgctcgcgcgcttcggccatgccaaggtgtcgctgccgggcggctgcgccatcggc
tcgcggccggtcgaccagcacatcaagggcctgcaggcgatgggtgccgagatcgtggtc
gagcacggctacatgatcgccagcctgccggccgggcgcacccgcctgaagggcgcgcgc
atcctgaccgacatggtcaccgtcaccggcaccgagaacttcctcatggccgccgcgctg
gccgagggcgagacgctgctcgagaacgccgcgcaggagcccgagatcgtcgacctggcc
gaaatgctgatccgcatgggcgcgaggatcgaaggccacggcaccagccacatccgcatc
cagggtgtcgagaagctgcacggctgcgagcacgccgtggtggccgaccgcatcgaggcc
ggcaccttcctgtgcgccgttgcggccaccggcggcgacgtgttcctgcgccacgcgcgg
gccgaccacatggacgcggtgatcgacaagctgcgcgacgccggctgcaccgtcgcggca
caggagggcggcgtgcgcatcagctccagcgccccggcctgcgagcacctcaaggcgcag
agcttcagcaccaccgaataccccggtttcccgaccgacatgcaggcccagttcatggcc
ctgaacgtgatcgcgcgcggcgcctcgatggtcaccgaaaccatcttcgagaaccgcttc
atgcacgtgaacgagatggtgcgcctgggcgccacgatccacgtcgagggcaaggtggcg
atggtcgagggcgtgcagcagctgtcgggcgccaccgtgatggcgaccgacctgcgcgcc
tcggccagcctggtgatcgccggcctcgtggccgatggcgagacgctggtcgaccgcatc
taccacctggaccgcggctacgaccgcatggaagccaagctgcgcggcctgggcgcggac
atcgaacgcatctcgggagccgccgcatga

DBGET integrated database retrieval system