KEGG   Variovorax paradoxus S110: Vapar_1165Help
Entry
Vapar_1165        CDS       T00916                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
vap  Variovorax paradoxus S110
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vap01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:vap00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1279653..1280975
Genome map
AA seq 440 aa AA seqDB search
MTPKAAPVRLSTASAGFDAEFKARLHWSADADAAIEKVVADILADVQRRGDEAVLEYTNR
FDKLDAKTLSELELTQAELKAAFESLPATQRDALEAAARRVRSYHEAQKKASGESWSYRD
ADGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVAEIIMVVPTPGGEKNQL
VLAAAYVAGVTRAFTIGGAQAVAALAYGTATIPAVDKITGPGNAYVAAAKRRVFGTVGID
MIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDAAYIDRVQAEIDRLLPG
MPRAEIIAASLNGRGALIHTKSMEEACEISNRIAPEHLEVSSSEPQRWEPLLRHAGAIFL
GAFTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEAGAQVLGPIAVTL
AEGEGLQAHAEAARMRLRRA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactccgaaagcagcccccgtccgcctctccacggcttcagccggcttcgacgctgaa
ttcaaggcgcggctgcattggtccgcggatgccgatgcggccatcgagaaggtggtggcg
gacatcctggccgacgtgcagaggcgcggggacgaggcggtgctggagtacaccaatcgc
ttcgacaagctcgatgcgaagacgctgtccgagctggagctaacgcaggccgaactcaag
gccgccttcgaatcattgccggccacgcagcgcgatgcgctcgaagccgccgctcgccgc
gtgcgcagctatcacgaggcgcagaagaaggccagcggcgagagctggagctatcgcgat
gccgacggcacgctgctcggccagaaggtcacgccgctcgatcgcgtcggcatctacgtg
ccgggcggcaaggcggcctatccgtcgagcgtgctgatgaatgccattccggctcacgtg
gccggcgtggccgaaatcatcatggtggttccgacgccgggcggcgaaaagaaccagctg
gtgctcgccgccgcctacgtggcgggcgtcacgcgcgccttcacgatcggcggcgcgcag
gccgtggccgcgctggcctacggcaccgccaccattcccgcggtcgacaagatcaccggc
cccggcaacgcctacgtggccgccgccaagcgccgcgtgttcggcaccgtgggcatcgac
atgatcgcgggcccgagcgaaatcctcgtcttggccgacggcagcacgccgcccgactgg
gtggcgatggacctgttcagccaggccgagcacgacgagctcgcgcaaagcatcctgctg
tgccccgacgccgcgtacatcgaccgcgtgcaggcagagatcgaccgcctgctgcccggc
atgccgcgcgccgagatcatcgcggcttcgctcaacggccgcggcgctctcatccacacc
aagagcatggaagaggcctgcgagatcagcaaccgcatcgcgccggagcacctggaagtc
agcagcagcgagccgcagcgctgggagccgctgctgcgccatgccggcgcgatcttcctg
ggcgccttcaccagcgagagcctgggcgactactgcgcgggccccaaccacgtgctgccc
acgagcggcacggcgcgcttctcgagcccgctgggcgtgtacgacttccagaagcgctcc
agcctcatcgaagtcagcgaagccggcgcgcaggtgctcggccccattgccgtcacgctg
gccgaaggcgaaggcctgcaggcgcacgccgaagcggcgcgcatgcggctgcgcagggcc
tga

DBGET integrated database retrieval system