KEGG   Variovorax paradoxus S110: Vapar_1280Help
Entry
Vapar_1280        CDS       T00916                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vap01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vap01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1395674..1396888
Genome map
AA seq 404 aa AA seqDB search
MLIPDSAVLSAAIDWLGHGLWDLTWWQVVLYTLVTTHITIAAVTIFLHRTQTHRAMDLGP
IPSHFFRFWLWLGTGMVTKEWVAIHRKHHAKCETEEDPHSPQVKGIDEVLWRGAELYRAE
SKNKETMERYGHGTPDDWLERNLYTRYSWQGVGLMLVINLALFGALGLTVWAVQMLWIPI
TAAGIINGIGHYWGYRNFEAPDASRNVSPWGLIIGGEELHNNHHTYPTSAKFSVKKYEFD
IGWVYIQMMQKIGWAKVKKVPPKMLMGDIQPVANEKTLEAVIANRYEVMAGYAREMRRVT
KAELAALKTKGGDISVLKAAKNWLHRDDDKVPASARSHLVQARAAHPVIDKMVTMREELR
QLWLNTSQSREQLAADLAAWCHRAEASGIAGLREFSTRLRAARA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttgattcctgactctgccgttttgagcgcggccatcgactggctcggacacggcttg
tgggacctcacatggtggcaagtcgtgctgtacacgctcgtcaccacgcacatcacgatc
gctgcggtcacgatcttcctgcaccgcacgcagacgcaccgggccatggatctgggcccg
atcccctcgcatttcttccgcttctggctgtggctcggcaccggcatggtgaccaaggaa
tgggtggccatccaccgcaagcaccacgccaagtgcgaaaccgaagaagacccgcacagc
ccgcaggtcaagggcatcgacgaagtcctgtggcgcggcgccgagctgtatcgtgccgag
tcgaagaacaaggaaacgatggagcgctacggccacggcacgcccgacgactggctcgag
cgcaacctgtacacccgctacagctggcagggcgtgggcctcatgctggtcatcaacctg
gcgctgttcggcgcgctcggcctcacggtctgggccgtgcagatgctgtggatcccgatc
accgcggccggcatcatcaacggcatcggccactactggggctaccgcaacttcgaggcg
ccggacgccagccgcaatgtctcgccctggggcctgatcatcggtggcgaagagctgcac
aacaaccaccacacgtatcccacctcggccaagttctcggtcaagaagtacgaattcgac
atcggctgggtctacatccagatgatgcagaagatcggctgggccaaggtcaagaaggtg
ccgccgaagatgctgatgggcgacatccagcccgtggccaacgagaagacgctcgaggcc
gtcattgccaaccgctatgaagtcatggccggctatgcccgcgagatgcgccgcgtcacc
aaggccgaactggctgcgctcaagaccaagggcggcgacatttcggtgctcaaggcggcc
aagaactggctgcatcgcgacgacgacaaggtgcccgcatcggcccgctcgcacctcgtg
caggcgcgcgctgcccacccggtgatcgacaagatggtcaccatgcgcgaagagctgcgc
cagctctggctcaacacctcgcagtcgcgcgagcagttggcggccgacctggcggcctgg
tgccaccgcgcggaggccagcggcatcgccggcctgcgcgagttctcgacccgcttgcgc
gctgcacgcgcctga

DBGET integrated database retrieval system