KEGG   Variovorax paradoxus S110: Vapar_1280Help
Entry
Vapar_1280        CDS       T00916                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Vapar_1280
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Vapar_1280
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Vapar_1280
Lipid biosynthesis proteins [BR:vap01004]
 Desaturase
  First
   Vapar_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1395674..1396888
Genome map
AA seq 404 aa AA seqDB search
MLIPDSAVLSAAIDWLGHGLWDLTWWQVVLYTLVTTHITIAAVTIFLHRTQTHRAMDLGP
IPSHFFRFWLWLGTGMVTKEWVAIHRKHHAKCETEEDPHSPQVKGIDEVLWRGAELYRAE
SKNKETMERYGHGTPDDWLERNLYTRYSWQGVGLMLVINLALFGALGLTVWAVQMLWIPI
TAAGIINGIGHYWGYRNFEAPDASRNVSPWGLIIGGEELHNNHHTYPTSAKFSVKKYEFD
IGWVYIQMMQKIGWAKVKKVPPKMLMGDIQPVANEKTLEAVIANRYEVMAGYAREMRRVT
KAELAALKTKGGDISVLKAAKNWLHRDDDKVPASARSHLVQARAAHPVIDKMVTMREELR
QLWLNTSQSREQLAADLAAWCHRAEASGIAGLREFSTRLRAARA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttgattcctgactctgccgttttgagcgcggccatcgactggctcggacacggcttg
tgggacctcacatggtggcaagtcgtgctgtacacgctcgtcaccacgcacatcacgatc
gctgcggtcacgatcttcctgcaccgcacgcagacgcaccgggccatggatctgggcccg
atcccctcgcatttcttccgcttctggctgtggctcggcaccggcatggtgaccaaggaa
tgggtggccatccaccgcaagcaccacgccaagtgcgaaaccgaagaagacccgcacagc
ccgcaggtcaagggcatcgacgaagtcctgtggcgcggcgccgagctgtatcgtgccgag
tcgaagaacaaggaaacgatggagcgctacggccacggcacgcccgacgactggctcgag
cgcaacctgtacacccgctacagctggcagggcgtgggcctcatgctggtcatcaacctg
gcgctgttcggcgcgctcggcctcacggtctgggccgtgcagatgctgtggatcccgatc
accgcggccggcatcatcaacggcatcggccactactggggctaccgcaacttcgaggcg
ccggacgccagccgcaatgtctcgccctggggcctgatcatcggtggcgaagagctgcac
aacaaccaccacacgtatcccacctcggccaagttctcggtcaagaagtacgaattcgac
atcggctgggtctacatccagatgatgcagaagatcggctgggccaaggtcaagaaggtg
ccgccgaagatgctgatgggcgacatccagcccgtggccaacgagaagacgctcgaggcc
gtcattgccaaccgctatgaagtcatggccggctatgcccgcgagatgcgccgcgtcacc
aaggccgaactggctgcgctcaagaccaagggcggcgacatttcggtgctcaaggcggcc
aagaactggctgcatcgcgacgacgacaaggtgcccgcatcggcccgctcgcacctcgtg
caggcgcgcgctgcccacccggtgatcgacaagatggtcaccatgcgcgaagagctgcgc
cagctctggctcaacacctcgcagtcgcgcgagcagttggcggccgacctggcggcctgg
tgccaccgcgcggaggccagcggcatcgccggcctgcgcgagttctcgacccgcttgcgc
gctgcacgcgcctga

DBGET integrated database retrieval system