KEGG   Variovorax paradoxus S110: Vapar_1299Help
Entry
Vapar_1299        CDS       T00916                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00040  Pentose and glucuronate interconversions
vap00052  Galactose metabolism
vap00500  Starch and sucrose metabolism
vap00520  Amino sugar and nucleotide sugar metabolism
vap01100  Metabolic pathways
vap01130  Biosynthesis of antibiotics
Module
vap_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Vapar_1299
   00052 Galactose metabolism
    Vapar_1299
   00500 Starch and sucrose metabolism
    Vapar_1299
   00520 Amino sugar and nucleotide sugar metabolism
    Vapar_1299
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Vapar_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACS17950
JGI: Vapar_1299
UniProt: C5CRL8
Position
1:complement(1413656..1414546)
Genome map
AA seq 296 aa AA seqDB search
MPTPSTRIRKAVFPVAGFGTRFLPATKAQPKEMLPVVDKPLIQYAVEEAYAAGIRDMIFV
TGRNKRAIEDHYDTAYELESQLEASGKLELLNIARSVMPDDMTCSYVRQPRMLGLGHAVL
CAEHLVGNEPFAVLLADDLMVGPVGGAPVLAQMTAAFGKLGASVLAVQEVPLEHVKRYGI
VAGESIGDDLVKVDRMIEKPSPDKAPSRLGVAGRYILTPGVFDEIRNQPKGAGGEIQLTD
GIAALMKKEAVYAYAYKGIRYDCGSKEGFLQASVELALAHPEVGGQFREYLKSLEL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccactccctcgacacgcatccgcaaggccgtatttcctgttgcaggtttcggcacc
cgctttctgcccgccaccaaggcgcagcccaaggaaatgctgccggttgtcgacaagcca
ctcatccagtacgcggttgaggaagcctacgcggcgggcattcgcgacatgattttcgta
actggccgaaacaaacgtgccatcgaagaccactacgacaccgcctacgaactcgagagc
cagctcgaggccagcggcaagctcgaactgctcaacatcgcgcgctcggtcatgcccgac
gacatgacctgctcctacgtgcgccagccgcgcatgctggggctcggccatgcggtgctg
tgcgccgaacacctggtgggcaacgaacccttcgccgtgctgctggccgacgacctgatg
gtcggccctgtgggcggcgcaccggtgctcgcgcagatgacggccgccttcggcaagctc
ggtgcttcggtgctcgcggtgcaggaagtgccgctcgaacacgtcaagcgctacggcatc
gtggcgggcgaatcgatcggcgacgacctcgtgaaggtcgatcgcatgatcgagaagccc
tcgccggacaaggcaccttcgcgccttggcgtggcgggccgctacatcctcacgcccggc
gtgttcgacgagatccgcaaccagcccaaaggcgcgggcggcgagatccagctcaccgac
ggcatcgcggcgctgatgaagaaggaagcggtctacgcctatgcctacaagggcatccgc
tacgactgcggcagcaaggaaggcttcctgcaagcctcggtggagcttgcgctcgcgcac
cccgaggtcggcgggcagttccgcgaatacctcaagagcctggagctctga

DBGET integrated database retrieval system