KEGG   Variovorax paradoxus S110: Vapar_1375Help
Entry
Vapar_1375        CDS       T00916                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vap  Variovorax paradoxus S110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vap00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1497477..1498250
Genome map
AA seq 257 aa AA seqDB search
MAAKPVIVTRPAREAAQWADEFRAAGLDAEVLPLIAIEPAIDAEPLRAAWKRLADYAALM
FVSATAVEHFFLHAEEGQRATGPRFWATGPGTARALLRAGVPQDAIDAPPPDAARFDSEA
LWERVKGQVGQGVRVLIVRGGDAAGQPSGRDWLAREIDAAKGLRDTVVAYRRLPPSFDDA
ARALALDGAAGRAVWLFSSSEAIANLCDAMPGTGWHAACAVATHARIGEAARAAGFGAVR
VCPPLREALVASIESFT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagcccgtcatcgtcacgcggccggcgcgcgaggccgcgcagtgggcggac
gaattccgggccgccgggctggatgccgaggtgctgccgctgatcgccatcgagcccgcc
atcgacgcggagccgctgcgcgcagcgtggaagcggcttgcggactatgcggcgctgatg
ttcgtgagcgccacggcggtcgagcatttcttcctgcatgcggaagaagggcaacgcgca
accggaccgcgcttctgggccacgggaccgggcacggcgcgcgcgctgttgcgtgccggc
gtgccgcaagacgccatcgacgcaccgcctcccgacgccgcccgcttcgactccgaggcg
ctgtgggagcgcgtgaaagggcaggtcggccagggcgtgcgcgtgctgatcgtgcgcggc
ggcgatgcggccggccagccgagcggacgcgactggctcgcgcgcgagatcgacgccgca
aaggggttgcgcgacacggtggtcgcctaccggcgcctgccgccatccttcgacgacgcg
gcgcgtgcgctggcactcgacggcgccgcggggcgcgcggtctggctgttcagcagctcg
gaggccattgccaacctgtgcgatgccatgccgggcaccggctggcatgcggcatgcgcg
gtggcgacccatgcgcgcatcggcgaagccgcgcgggccgcgggattcggtgcggtgcgc
gtgtgcccgccgctgcgggaagccctggtcgcgtcgatagaatccttcacatga

DBGET integrated database retrieval system