KEGG   Variovorax paradoxus S110: Vapar_1405Help
Entry
Vapar_1405        CDS       T00916                                 

Definition
pyridoxine 5'-phosphate synthase (EC:2.6.99.2)
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
vap  Variovorax paradoxus S110
Pathway
Vitamin B6 metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:vap00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1527513..1528277
Genome map
AA seq 254 aa AA seqDB search
MSTSGQSATTSLSVNLNKVALVRNTRHLGIPSVLTAAKACLAAGAQGITVHPRPDERHIR
PHDVSDLAALLARDWPAIEFNIEGNPFHNLMDFVRTLKPHQATFVPDSETQSTSDHGWSF
PEDAERLRPLIAEAKALGVRVSLFMDPIPEMMAAAKAVGADRVELYTEGYASSRGTPDEQ
AVLARYVEAARAAQAAGLGLNAGHDLSRDNLTPFLRAVRGVQEVSIGHAFIADALELGYA
ATTKEYLRCIQEAQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttccggccaatccgctaccacctcgctgtcggtcaacctcaacaaggtggcc
ctggtgcgcaatacgcgccatctcggcattccgagcgtgctcaccgccgccaaggcctgc
cttgccgccggagcgcagggcatcaccgtgcacccccggcccgacgagcgccacatccgg
ccgcacgacgtgagcgacctggccgcgctgctggccagggattggcccgcaatcgagttc
aacatcgaaggcaacccctttcacaacctgatggacttcgtgcgcacgctgaagccgcac
caggccaccttcgtgcccgacagcgaaacccagtcgaccagcgaccatggctggagcttc
cccgaagacgccgagcggctgcgcccgctgattgccgaagccaaggccctgggcgtgcgc
gtgagcctcttcatggaccctattcccgagatgatggccgcggccaaggcggtgggcgcc
gaccgcgtcgagctctataccgagggctatgcctcatcgcgcggcacgccggacgaacag
gccgtgctggcgcgctatgtcgaagccgcccgcgcggcgcaggcggcgggcctcggcctc
aatgcgggccacgacctgagccgcgacaacctcacgccgttcctgcgtgcggtgcgcggc
gtccaggaggtgtcgatcgggcatgccttcatcgccgatgcgctcgaactgggctacgcc
gccaccaccaaggaatacctgcgctgcatccaagaggcgcagtga

DBGET integrated database retrieval system