KEGG   Variovorax paradoxus S110: Vapar_1407Help
Entry
Vapar_1407        CDS       T00916                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vap  Variovorax paradoxus S110
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Vapar_1407
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Vapar_1407
Enzymes [BR:vap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Vapar_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1528680..1529786
Genome map
AA seq 368 aa AA seqDB search
MTAGPARTHAPLIIDVAATELNDADRRRIANPLVGGVIHFARNWQDRAQMSALNAEIKAI
RPDLLICVDHEGGRVQRFRTDGFTRLPSMRALGELWMRDAMRATQAATAAGQVLAAELRA
CGVDFSFAPVLDLDYGGSSVIGDRSFHRDPRVAALLAKSLMHGMLQMGMRNCGKHFPGHG
FVTADSHVEIPVDRRSLKAILADDARPYDWLAGTLTAVMPAHVIYPKVDKRPAGFSSRWL
EDILRSRLGFDGAIFSDDLSMEAGRYIDGELLSYADAALAALDAGCDLAMLCNQSIGDGR
PLDELLDGFAAAASAGRWQPDANSEARRRALLPETPPLGWNALADSAGYRQARQVLAQAG
LAAPRQGA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgggcccgcccgcacccacgcgccgctgatcatcgacgtggcggcgaccgaa
ctgaacgacgccgaccgtcggcgcatcgccaatccgctggtcggcggcgtgatccacttc
gcccgcaactggcaggaccgtgcgcagatgagcgcgctcaatgccgagatcaaggcgatc
cgccccgacctgctgatctgcgtggaccacgaaggcggccgggtgcagcgctttcgcacc
gacggcttcacgcgcctgccctcgatgcgcgcgctcggcgagctgtggatgcgcgatgcg
atgcgcgccacgcaggccgcaacggccgccggccaggtgcttgccgccgaactgcgcgcc
tgcggcgtcgacttcagctttgcgccggtgctcgacctcgattacggcggcagcagcgtg
atcggcgaccgcagcttccaccgcgacccgcgcgtggcggcgctgctggccaagagcctg
atgcacggcatgctgcagatgggcatgcgcaactgcggcaagcactttccggggcacggc
ttcgtcaccgccgattcgcatgtggaaatcccggtcgaccggcgcagcctcaaggccatt
ctggccgacgatgcgcggccctacgactggctcgcgggcacgctcaccgcagtgatgccg
gcgcacgtgatctatccgaaggtcgacaagcggcccgcgggcttttcttccaggtggctg
gaggacatcctgcgcagcaggctcggtttcgatggcgccatcttcagcgatgacctgagc
atggaagcagggcgctacatcgacggcgagctgctgagctatgccgatgccgcgctggcg
gcactcgacgcgggctgcgacctggcgatgctgtgcaaccagagcatcggcgatggccgc
ccgctcgacgaactgctcgacggctttgccgccgcggccagtgcggggcgctggcagccc
gatgcgaacagcgaggcgcgccgccgggcgctgctgccggaaacgccgccgctcggctgg
aacgcgctcgccgattcggcgggctatcggcaggcgaggcaagtacttgcgcaggccggg
cttgcggcgcctcgacagggcgcctga

DBGET integrated database retrieval system