KEGG   Variovorax paradoxus S110: Vapar_1415Help
Entry
Vapar_1415        CDS       T00916                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vapar_1415
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_1415
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Vapar_1415
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Vapar_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(1536415..1537692)
Genome map
AA seq 425 aa AA seqDB search
MRTNYQQPDATGHFGNYGGTFASETLTHAINELRDAYAKYKDDPAFLAEFHYELKHFVGR
PSPVYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQ
HGVATATICARYGLECVVYMGSQDVKRQSPNVYRMNLLGATVVPVESGSKTLKDALNEAM
RDWVTNVENTFYIIGTVAGPHPYPTMVRDFQSVIGTECIDQMPAMLAAQGITGEAEGRQP
DVVVACVGGGSNAMGIFHPYIPFEGTRLIGVEAAGEGLDSGKHSASILRGSPGVLHGNRT
YLLQNEDGQVTETHSISAGLDYPGVGPEHAYLADIGRAEYVGITDAEALEAFHYLCRTEG
IIPALESSHAVAYAMKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGLS
VKGGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccaactaccagcaacccgacgccaccggccacttcggcaactacggcggcacc
ttcgcgagcgaaacgctcacccacgcgatcaacgagctgcgcgacgcctacgcgaagtac
aaggacgatccggccttcctcgccgaattccactacgaactcaagcacttcgtcggccgc
ccctcgccggtctaccacgcggcgcgcaccagccgcgagatgggcggcgcgcagatctac
ctgaagcgcgaagacttgaaccacaccggcgcccacaagatcaacaacgtgatcggccag
gcgatgctcgcgcgccgcatgggcaagccccgcgtgatcgccgaaaccggcgccggccag
catggcgtggccaccgccaccatctgcgcgcgctacggcctcgaatgcgtggtctacatg
ggcagccaggacgtgaagcgccagagccccaacgtctaccgcatgaacctgctcggcgcc
accgtggtgccggtggagtcgggcagcaagacgctgaaggacgcgctcaacgaggccatg
cgcgactgggtcacgaacgtggagaacaccttctacatcatcggcaccgtggccggcccg
cacccctacccgaccatggtgcgcgacttccagagcgtgatcggcacggagtgcatcgac
cagatgcccgccatgctcgcggcccagggcatcaccggcgaagccgagggccggcagccc
gacgtggtggtggcctgcgtgggcggcggcagcaacgcgatgggcatcttccatccctac
atcccgttcgaaggaacgcgcctgatcggcgtggaggccgcgggcgaagggctcgacagc
ggcaagcactcggcatccatcctgcgcggcagccccggcgtgctgcacggcaaccgcacc
tacctgctgcagaacgaggacggccaggtgaccgaaacgcacagcatcagcgccgggctc
gactatcccggcgtgggccccgagcacgcctacctggccgacatcggccgcgccgagtac
gtcggcatcaccgacgccgaggcactcgaagcctttcactacctgtgccgcaccgaaggc
atcattccggccctcgaatcgagccacgccgtggcctacgccatgaaactcgccaagacc
atgcggccggaccagtcgatcctcgtgaacctctcgggccgcggcgacaaggacatcggc
accgtcgccgacctgtcgggcgtcgacttctacgaccggccctcgatgcgcggcctgagc
gtgaagggaggcaagtga

DBGET integrated database retrieval system