KEGG   Variovorax paradoxus S110: Vapar_1429Help
Entry
Vapar_1429        CDS       T00916                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vap  Variovorax paradoxus S110
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_1429
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_1429
   00650 Butanoate metabolism
    Vapar_1429
  Energy metabolism
   00190 Oxidative phosphorylation
    Vapar_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1552387..1552752)
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRIVVGAHYGLRDWLSQRITGGLMALFTIILLAQLIFTRGPIGYDLWAGIFAA
QWMKVLTFCVIASLLYHVWVGMRDVWMDYVQPVGIRLALQIFTIVWLVGCAGWAIQVLWK
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaactacggctccaagcgcatcgtcgtcggcgcgcactacggtttgcgcgac
tggctcagccagcgcatcacgggcggcctgatggcgctcttcacgatcatcctgctcgcg
cagctgatcttcacgcgcggccccatcggctacgacctgtgggccggcatcttcgccgcg
cagtggatgaaggtgctgaccttctgcgtgatcgcctccctgctctaccacgtgtgggtc
ggcatgcgcgacgtgtggatggactacgtccagcccgtcggcattcgccttgccctgcaa
attttcaccatcgtctggcttgtcggttgtgcgggttgggccattcaagtgctttggaag
atctga

DBGET integrated database retrieval system