KEGG   Variovorax paradoxus S110: Vapar_1468Help
Entry
Vapar_1468        CDS       T00916                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vap  Variovorax paradoxus S110
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vap00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1591602..1592060
Genome map
AA seq 152 aa AA seqDB search
MQAFVAIGANLGDARAAVTAAMDAIGTIERTVVTARSSLYRSAPVDAAGPDFINAVVAVR
TGLTAEAFLAELHLLEEQAGRERPFPNAPRTLDLDLLMHGNAIKDTPALALPHPRMRDRA
FVLKPLAEIAPDKVPRAALARVSSQVIERIRD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccttcgtcgccatcggcgccaatctcggcgacgcccgggccgccgtgacggcg
gccatggacgccatcggcaccatcgagcgcaccgtggtgacggcgcgctcgtcgctctac
cgcagcgcgccggtcgatgcggccgggcccgatttcatcaacgccgtggtggccgtgcgg
accgggctcacggccgaggccttcctggccgagctgcacctgctcgaggagcaggccggc
cgcgagcggccttttcccaatgcgccgcgcacgctcgacctcgacctgctgatgcacggc
aacgcgatcaaggacacgcccgcgctggccttgccccacccgcgcatgcgcgaccgcgcc
ttcgtgctgaagccgcttgccgagatcgcgcccgacaaggtgccgcgcgcggcgcttgcc
cgcgtttcctcgcaggtcatcgagcggattcgcgactga

DBGET integrated database retrieval system