KEGG   Variovorax paradoxus S110: Vapar_1663Help
Entry
Vapar_1663        CDS       T00916                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vap  Variovorax paradoxus S110
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Vapar_1663
   00670 One carbon pool by folate
    Vapar_1663
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Vapar_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1797669..1798202)
Genome map
AA seq 177 aa AA seqDB search
MSELATTPRIHLIFARAANGVIGAKGTIPWHLPEDMVHFKQQTAGAPVVMGRKTWDSLPP
RFRPLPGRRNIVVTRQDDWKAEGAWRVGSLQEALALCEESQVPDVWIIGGAQIYAEAEPL
AQQVVVTELAHDYEGDAHAPELSPSAWRETKREAHVSAKEGLNYSFVTYERIAPSKA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagctcgccacgacaccgcgcatccacctgatcttcgcgcgcgccgccaacggc
gtgatcggcgccaagggcaccattccctggcacctgcccgaagacatggttcacttcaag
cagcagacggccggcgccccggtcgtcatgggccgcaagacctgggattcgctgccgccg
cgcttccggccgctgccgggccgccgcaacatcgtcgtgacgcggcaggacgactggaag
gccgaaggcgcatggcgcgtgggcagcctgcaggaagcgctcgcgctgtgcgaggaatcg
caggtgcccgacgtgtggatcatcggcggcgcgcagatctacgccgaggccgagccgctc
gcgcagcaggtggtcgtgaccgagctcgcgcacgactacgaaggcgatgcgcatgcgccg
gagctctccccctccgcctggcgcgaaaccaagcgcgaagcgcatgtctcggcgaaggag
ggcctcaactacagcttcgtgacctacgaacgcatcgcgccatcgaaggcatga

DBGET integrated database retrieval system