KEGG   Variovorax paradoxus S110: Vapar_1778Help
Entry
Vapar_1778        CDS       T00916                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00071  Fatty acid degradation
vap00280  Valine, leucine and isoleucine degradation
vap00281  Geraniol degradation
vap00310  Lysine degradation
vap00360  Phenylalanine metabolism
vap00362  Benzoate degradation
vap00380  Tryptophan metabolism
vap00410  beta-Alanine metabolism
vap00627  Aminobenzoate degradation
vap00640  Propanoate metabolism
vap00650  Butanoate metabolism
vap00903  Limonene and pinene degradation
vap00930  Caprolactam degradation
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01212  Fatty acid metabolism
Module
vap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Vapar_1778
   00650 Butanoate metabolism
    Vapar_1778
  Lipid metabolism
   00071 Fatty acid degradation
    Vapar_1778
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_1778
   00310 Lysine degradation
    Vapar_1778
   00360 Phenylalanine metabolism
    Vapar_1778
   00380 Tryptophan metabolism
    Vapar_1778
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Vapar_1778
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Vapar_1778
   00281 Geraniol degradation
    Vapar_1778
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Vapar_1778
   00627 Aminobenzoate degradation
    Vapar_1778
   00930 Caprolactam degradation
    Vapar_1778
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Vapar_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF4128
Motif
Other DBs
NCBI-ProteinID: ACS18428
JGI: Vapar_1778
UniProt: C5CUK0
Position
1:complement(1913557..1914336)
Genome map
AA seq 259 aa AA seqDB search
MNTSASVRTEIDGPVSTIVMSRPKQRNAVDRPMADALRAAFERFEADQSQRVAVLWGEHG
SFCAGADLGAVGDPARRNELDPEGGGTGPMGPTRMALAKPLIAAISGHAVAGGLELALLA
DLRVAEEDAVLGVFCRRWGVPLIDGGTVRLPRIVGMGRALDLILTGRPVSAPEAQAMGLV
NRVVPLGQARHAAEALAREIASFPQQCMLADRQSAHAQWSLPLADALRQEGRLGVPIVAA
EGAAGAERFVRGAGRHGTF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgtccgccagcgtccgcaccgagatcgatgggccggtcagcaccatcgtcatg
agccgcccgaagcagcgcaacgccgtcgaccggcccatggccgacgcgctgcgcgccgcc
ttcgagcgcttcgaagccgatcaaagccagcgcgttgcggtgctctggggcgagcacggc
agcttctgcgccggcgccgacctgggcgcggtcggcgaccccgcgcgccgcaacgaactc
gaccccgagggcggcggcacgggcccgatgggcccgacccgcatggcgcttgccaagccc
ctgatcgccgccatcagcggccatgcggtggccggcggcctggagctggcgctgctggcc
gacctgcgcgtggccgaggaagatgccgtgctcggcgtgttctgccggcgctggggcgtg
ccgctgatcgacggcggcacggtgcggctgccgcgcatcgttggcatgggccgcgcgctc
gacctgatcctgaccggacggcccgtgagcgccccggaagcgcaggccatgggcctggtc
aaccgcgtggtgccgctcggccaggcccgccacgcggccgaagcgctcgcgcgcgagatc
gcgtcgttcccgcagcagtgcatgctggcggaccgccaatccgcccatgcccaatggagc
ctgccgctggccgatgcgctaaggcaggaaggccggctcggcgtgccgatcgtcgcggcc
gaaggcgcggccggtgccgaacgcttcgtgcgcggcgcggggcggcacggcaccttctga

DBGET integrated database retrieval system