KEGG   Variovorax paradoxus S110: Vapar_1798Help
Entry
Vapar_1798        CDS       T00916                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vap  Variovorax paradoxus S110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1934117..1934890
Genome map
AA seq 257 aa AA seqDB search
MATQRPGFPVRLTPTASAATRGRLPAVPAKPMVPATPSMASDAVRTRMVQKLAAQGIADA
RVLRALSAVERHRFVDSALVNQAYEDTSLPIGLGQTISKPSVVARMIELLLGAPALAGKP
QDRLGRVLEIGTGCGYQAAVLNHVATEVYSIERLRGLHERARANLRHFRLATVHLMLGDG
MVGYAKGAPYAGIIAAAGGEAVPQAWIEQLAVGGRIVAPTHSAGGGQALVVIDKTARGLE
RRILEAVHFVPLKSGIA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaacggcctggattcccggttcgcctgacacccaccgcctcggccgccacg
cgcgggcgcctgcccgccgtgcctgccaagccgatggtgcctgccacgccttcgatggcc
tccgacgccgtgcgcacgcgcatggtgcagaagctcgccgcccagggcattgccgatgcg
cgcgtgctgcgcgcgctgagcgcggtcgagcggcatcgcttcgtcgacagcgcgctggtc
aaccaggcctatgaagacacgagcctgccgatcgggctgggccagaccatctccaagccg
agcgtggtggcccgcatgatcgagctcctgctgggcgcgccggcactggccggcaagccg
caggaccgtctcggtcgcgtgctggaaatcggcactggctgcggctaccaggccgcagtg
ctgaaccacgtggccacggaggtctacagcatcgagcgcctgcgcggactgcacgagcgc
gcgcgcgccaacctgcggcatttccggctggccacggttcacctgatgctgggcgacggc
atggtcggctatgccaagggtgcgccctatgccggcatcatcgccgcggcaggcggcgaa
gcggtgccgcaggcctggatcgaacaactcgccgtcggcggacgcatcgtggcgcccacg
cactcggcaggcggcgggcaggcgctcgtcgtcatcgataaaaccgcccgtggactcgag
cgccgcattcttgaggcggttcactttgtccccctaaaatcgggcatcgcttga

DBGET integrated database retrieval system