KEGG   Variovorax paradoxus S110: Vapar_1832Help
Entry
Vapar_1832        CDS       T00916                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Vapar_1832
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_1832
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Vapar_1832
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Vapar_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1964826..1966241
Genome map
AA seq 471 aa AA seqDB search
MNYLSTRGHPDRKRFCEILLEGLAPDGGLYLPEHYPQVDTATLAKWRELPYAELAFEILS
LYIDDIPPADLKAICARTYTAEVFGSDEIVPLRELEDGVYLEALSNGPTLAFKDMAMQLL
GNLFEYELARRGAELNILGATSGDTGSAAEYAMCGKKGVRVFMTSPDGRMSPFQQAQMFS
LQDQNIHNIAISGVFDDCQDIVKAVSNDLGFKRKYRIGTVNSINWARLLAQVVYYFAGYF
QATASNDKPVSFTVPSGNFGNVCAGHVARMMGLPIQTLVVATNENDVLDEFFRTGIYRVR
AAADTHETSSPSMDISKASNFERFVFDLVGRDAGRLRSLFVDDLGRQGRFDLSADPAFRQ
AAERFGFKSSRSTHADRLATIRDTDKRFATLVDPHTADGLKAAREHLAPGVPMVVLETAL
PIKFAATLVEALGHEPARPAKFEGIEALPKRVVKLPADAEAVKAYIAQNCD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaactacctgagcacccgcggccaccccgaccgcaagcgtttctgcgaaatcctgctt
gaaggcctcgcgcccgatggcggcctgtacctgcccgagcactacccgcaggtcgacacc
gccacgctcgccaaatggcgcgagctgccgtatgcggaactggcgttcgagatcctctcg
ctctacatcgacgacattccgccggccgacctgaaggcgatctgcgccaggacctacacg
gccgaagtgttcggcagcgacgagatcgtgccgctgcgcgagctggaagacggcgtgtac
ctcgaggccctgtcgaacggccccacgctggccttcaaggacatggcgatgcagctgctg
ggcaacctgttcgagtacgaactggcccgccgcggcgccgagctcaacatcctgggcgcc
accagcggcgacaccggcagcgcggccgagtacgccatgtgcggcaagaagggcgtgcgc
gtcttcatgacctcgcccgacggccgcatgagcccgttccagcaggcgcagatgttcagc
ctgcaggaccagaacatccacaacatcgccatcagcggcgtgttcgacgactgccaggac
atcgtcaaggcggtgtcgaacgacctgggcttcaagcgcaagtaccgcatcggcacggtc
aactcgatcaactgggcgcggctgctcgcgcaggtcgtctactacttcgcaggctacttc
caggccacggcgagcaacgacaagcccgtgagcttcacggtgccctcgggcaacttcggc
aacgtctgcgcgggccacgtggcgcgcatgatgggcctgccgatccagacgctggtggtt
gccaccaacgagaacgacgtgctcgacgagttcttccgcaccggcatctaccgcgttcgc
gcggcggccgacacgcacgaaacctcgagcccgtcgatggacatcagcaaggccagcaac
ttcgagcgcttcgtgttcgacctcgtgggtcgcgatgccggcaggctgcgctcgctgttc
gtcgacgatctgggccgccagggccgtttcgacctgagcgccgatcccgccttcaggcag
gccgcggagcgcttcggcttcaagagcagccgcagcacccatgccgaccgcctggccacc
atccgcgacaccgacaagcgctttgccacgctggtcgatccgcacacggccgacggcctc
aaggctgcgcgcgaacacctcgcgcccggcgtgccgatggtggtgctggagaccgcgctg
ccgatcaagtttgccgccacgctggtggaggcgctgggccacgagcccgcacgcccggcc
aagttcgaaggcatcgaggcgctgcccaagcgggtcgtcaagctgccggccgatgccgag
gccgtgaaggcctacatcgcgcagaactgtgactga

DBGET integrated database retrieval system