KEGG   Variovorax paradoxus S110: Vapar_1984Help
Entry
Vapar_1984        CDS       T00916                                 

Definition
bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase (EC:2.4.1.25 5.4.99.15)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
vap  Variovorax paradoxus S110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vap00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2127547..2132568
Genome map
AA seq 1673 aa AA seqDB search
MLERLCRHYGISPAYHDAFGTLRHASPENLAALLAEFGVQAGAATGAEADAPAMPPVQVV
QAHAPHWSLQLPQRSGSLRWRLRDEQGLVREGEADAQPWPHGSCTLQLAEPLAPGYHWLQ
IDGLAGETLLVASPGRCYRPPAVQDGGRVWGPALQLYALRSARNWGIGDFGDLEALVDRM
AGQGTDLIGLNPLHALFPTDPPRASPYSPSSRQWINVLYIDVEAVDDFAACEAARRHVES
PGFQGRLAALRAAPLVDHAGVATAKFEVLELLFEHFRARHLSPAGAPDARGEAFLAFVSA
QGEPLRQHALFEALQAHFAAADPQCWGWLAWPEAYREADSPEVQAFAAEHAERLQYHQYL
QWVAEHQLARAGERCKALGMGIGLYLDLAVSVDRGGSDAWAARHCFAVGASIGAPPDEFN
PAGQNWGLPPLRPDHLRTHHYQPFVQMLRANMRHAGALRIDHVMGLMRLFWIPPGRSPHD
GAYVRYAVEEMLAIVAVESHRHGCMVVGEDLGTVEDAMREALARADVLSYRLLYFEKQQG
GGFTLPAAYPAAALVAISTHDLATLAGWWSGHDLRLRLALGLFPDPRLFDAQLLDRAQER
IRLTLAVREAGLLSADEAAQALSLAVPSPRIMQAVHAFLAAAPSALMVFQLEDVAGEVEQ
ANMPGTTDTHPNWRRKLLPSVQELAAGDAMQGLTEHLRAIRPRRSLRAEAAPSTLLQARV
PRATYRLQFHQGFGFDDAIRVLPYLAQLGVSHVYCSPIQRARAGSTHGYDVVAHAEVNPE
LGGAEGFARFVAALQAHGLGQLLDMVPNHMGVLGADNAWWMDVLENGPASLFAHHFDIDW
QPLNKELAGKVLLPVLGGHYGEVLASGELALHFEAAHGSFALRYFDHRFPLAPESYPVVL
ACALPHLKDPMLAAQLASLSAAFGHLPSRRAQTPAECTERVRDKELFKARLAHLAEAHPS
LARAVLAAVAEFNLASEEARDQLHRLIDLQAFRLAYWRVAADEINYRRFFDINDLAAVRM
ERDEVFEATQSFALDLAAAGVVDGLRIDHPDGLYDPARYFRQLQEGYARRAGIVLPATGP
DGRPARPLYVVAEKIAASEEEVPAEWHVHGTTGYRFANVANGVLVDTAAADALRQAWHGF
TGEAQDFGSVARAGKREVMRSALSSELNVLSSELLRIARADRGTRDYTLNALRRALAEVA
ACMPVYRTYIVDAPSAQDAHFIDAATEAAERQSVDADRSVFAFVRRSLRGEAAAAHAPPA
LAGRVRRFAMRFQQFSAPVAAKGVEDTSFYRYFPLSSLNEVGGEPDQFGFDVPEFHALSA
DRARHWPHTMLATSTHDNKRSEEVRNRIDVLSEMPSEWRDALARWHALCRGGEQAEAAPS
RADEYLLYQTLLGTLPFGGLDAADVPAYAARVWQYMQKAAREAKLHTRWTQPDAPYEAAL
EGLVQRILSDLSKDGCLADIQRLADRLSWFGAWNGLTLTLLKYGSPGVPDLYQGSELIDL
SLVDPDNRRPVDYELRSRRLDELQAMAGGHDLAARVQALAGSPHDGRAKLWFIWRLLSMR
RSHAELFREGSYEGLAGEGPLARHVVAFARRHEGRTLVVMAGRLFAGIACAGADGVPVLP
DAEAWRGTRVVLPEDLGGATLVNVLTGESLAAEDRVVSLKDAFCRMPWAIFQK
NT seq 5022 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagcgcctgtgccggcactacggcatctcgccggcctaccacgacgccttcgga
acgctgcgccatgcatcgcccgagaacctggccgcgctgctggccgagttcggcgtgcag
gcgggtgccgcaactggcgcagaggccgatgcgcccgccatgccaccggtgcaggtggtg
caggcgcatgcaccgcactggtcgctgcagctgccgcagcgctcaggcagcctgcgctgg
cggctgcgcgacgagcaggggctcgtgcgcgagggcgaagccgacgcgcagccctggccg
catggcagctgcacgctgcagctggccgagccgctcgcgcccggctatcactggctgcag
atcgacggcctggccggcgagaccctgctcgtcgcttcgcccggccgctgctaccgcccg
cccgccgtgcaggacggtggccgcgtctgggggccggcgctgcagctgtatgcgctgcgt
tcggcgcgcaactggggcatcggcgatttcggcgacctcgaagcgctcgtcgaccgcatg
gccgggcagggcaccgacctgatcggcctgaacccgctgcatgcgctgttcccgaccgat
ccgccgcgcgccagcccctacagcccgtcgtcgcggcaatggatcaacgtgctgtacatc
gacgtcgaggcggtcgacgacttcgccgcctgcgaggccgcgcgccggcacgtcgaatcg
ccggggttccagggccggctcgcggcgctgcgggccgcgccgctggtcgaccatgccggc
gtggccaccgccaagttcgaagtgctggagctgctgttcgagcactttcgcgcgcggcat
ctttcgccggccggcgctcccgatgcacgcggcgaggccttcctggcctttgtctcggcg
cagggcgagccgctgcgccagcacgccttgttcgaggcgctgcaggcccactttgccgcg
gccgatccgcagtgctggggctggctcgcctggcccgaagcctatcgggaggcggattcg
cccgaggtgcaggcctttgcggccgagcatgccgagcggctgcaataccaccagtacctg
caatgggtggccgagcaccagcttgcgcgcgcgggcgaacgctgcaaggcgctgggcatg
ggcatcgggctctacctggacctggccgtgtcggtggaccgcggcggctccgacgcctgg
gccgcgcgccactgcttcgcggtcggcgcgagcatcggtgcgccgcccgacgagttcaac
ccggccgggcagaactggggcctgccgccgctgcgccccgaccacctgcgcacgcaccac
taccagcccttcgtgcagatgctgcgcgccaacatgcggcatgccggcgcgctgcgcatc
gaccatgtgatggggctgatgcgtctgttctggattccgccgggccgctcgccgcacgac
ggcgcctacgtgcgctacgcggtcgaggagatgctggccatcgtggcggtcgaaagccat
cggcatggctgcatggtggtgggcgaagacctgggcacggtggaagacgcgatgcgcgaa
gcgctcgcgcgcgccgatgtgctctcctaccggctgctctacttcgagaagcagcagggc
ggcggcttcacgctgcctgcggcctacccggcagccgcgctggtggccatcagcacgcac
gacctcgccacgctcgcgggttggtggtcgggccacgacctgcggctgcggttggcgctc
gggctttttcccgatccgcggctgttcgatgcgcagctgctggaccgcgcgcaggaacgc
atccggctgacgctggccgtgcgcgaggcgggcctgctgtccgccgacgaggcggcgcag
gcgctgtcgctcgcagtgccttcgccgcgcatcatgcaggcggtccacgcgttcctggcc
gcggcgccgtcggcgctgatggtgttccagctcgaggacgtggccggcgaggtggagcag
gccaacatgcccggcaccaccgacacccatcccaactggcggcgcaagctgctgcccagc
gtgcaggagctggcggcgggcgatgcgatgcaggggctcacggaacacctgcgcgcgatt
cgcccgcgccgcagcctgcgcgcggaagcggcgccgtccacgctgctgcaggcgcgcgtg
ccgagggccacctaccgcctgcagttccaccagggcttcggcttcgacgatgcgatccgc
gtgctgccctatctcgcgcagctcggcgtgagccatgtgtattgctcgcccatccagcgc
gcccgcgcgggcagcacgcacggctacgacgtggtggcccatgccgaggtcaatcccgag
ctcggcggcgccgagggctttgcgcgcttcgtcgcggcgctgcaggcgcacggcctcggg
cagctgctcgacatggtgcccaaccacatgggcgtgctcggcgccgacaacgcctggtgg
atggacgtgctggagaacggcccggcctcgctcttcgcgcatcacttcgacatcgactgg
cagccgctcaacaaggagctggccggcaaggtgctgctgccggtgcttggcgggcactat
ggcgaggtgctcgcgagcggggagctggcgctgcacttcgaagcggcgcacggcagcttc
gcgctgcgctacttcgaccaccggtttccgctggcgcccgaaagctatcccgtggttctt
gcatgcgcattgccgcacctgaaggacccgatgctcgcagcgcagctcgccagcctctcg
gccgccttcggccacctgcccagccgccgtgcgcagacgcccgccgaatgcaccgagcgc
gtgcgcgacaaggaactgttcaaggcccgcctcgcgcatctggcagaggcgcatccgtcg
ctcgcgcgcgccgtgctggccgcggtggcggagttcaacctggcgtcggaagaggcgcgc
gaccagctgcaccggctcatcgacctgcaggccttccggctcgcctactggcgcgtggcg
gccgacgaaatcaactaccggcgcttcttcgacatcaacgacctggcggcggtgcgcatg
gaacgcgacgaggtgttcgaggccacccagtccttcgcgctcgaccttgccgcggccggc
gtggtggacggcctgcgcatcgaccatcccgatggcctgtacgaccctgcgcgctacttc
cggcagctgcaggaaggctatgcgcgccgcgcgggcatcgtgctgccggctaccggcccc
gatggacggccggcgcgcccgctgtacgtggtggccgagaagatcgccgcctcggaagaa
gaggtgcccgccgaatggcatgtgcacggcaccaccggctaccgctttgccaacgtggcc
aacggcgtgctcgtggacaccgccgcggccgacgccctgcggcaggcctggcatggcttc
acgggcgaggcgcaggacttcggctcggtcgcaagggccggcaagcgcgaggtcatgcgc
agcgcgctgtcgtcggagctcaacgtgctctcctccgaactgctcaggattgcgcgggcc
gaccgcggcacacgcgactacacgctcaacgcgctgcgccgcgcgctcgccgaagtggcg
gcctgcatgccggtctaccgcacctacatcgtcgacgcaccctccgcgcaggacgcgcat
ttcatcgacgccgccaccgaggcggccgagcgccagagtgtcgatgccgaccgctccgtc
ttcgccttcgtgcgccgctcgctgcgcggcgaggccgcggccgcgcatgcgccaccggcg
ctggccgggcgcgtgcgccggttcgcgatgcgcttccagcagttcagcgcgccggtcgcg
gccaagggcgtggaggacacctcgttctaccgctactttccgctcagttcgctcaatgag
gtcggcggcgagccggaccagttcggtttcgacgtgcccgagttccatgcattgagcgcc
gaccgcgcgcggcactggccgcacaccatgctcgcgacctccacgcacgacaacaagcga
tcggaagaggtgcgcaaccgcatcgacgtgctctccgaaatgcccagcgagtggcgcgac
gcgctcgcgcgctggcacgcgctgtgccgcggcggcgagcaggcggaggcagcgccttcg
cgcgccgacgaatacctgctctaccagaccctgctcggcaccttgcccttcggcggcctc
gatgctgccgacgtgccggcctatgccgcgcgtgtgtggcagtacatgcagaaggccgcg
cgcgaagccaagctccacacgcgctggacccagcccgatgcaccgtacgaagcggcgctc
gaaggcctggtgcagcggatcctctcggacctgtcgaaggacggctgccttgcggacatc
cagcgcctggccgatcgcttgtcatggttcggtgcgtggaacggcttgacgctcacgctg
ctgaagtacggctcgccgggcgtgccggatctctatcaaggaagcgagctgatcgacctg
agcctggtcgatcccgacaaccggcggccggtggactatgaactgcgcagccgtcggctc
gatgagctccaggcgatggcaggcgggcacgaccttgctgcgcgcgtgcaggcgctggcc
gggtcgccgcacgatggccgcgcgaagctctggttcatctggcggctgctgtcgatgcgg
cgctcgcatgcggaactattccgcgaaggcagctacgaagggctcgcgggcgaagggccg
ctggcgcggcatgtggtggcctttgcgcgcaggcacgaagggcggacgctggtggtgatg
gcggggcggttgtttgcggggattgcgtgcgccggggcggatggtgtgccggtgcttccc
gatgcggaggcgtggagggggacgagggtggtgttgcctgaggatctcggaggcgcaacg
ctggtgaacgtgctcaccggcgaatcgctggctgccgaggatcgcgtcgtctcgctgaaa
gatgcgttctgccgcatgccttgggctatcttccaaaaatag

DBGET integrated database retrieval system