KEGG   Variovorax paradoxus S110: Vapar_2163Help
Entry
Vapar_2163        CDS       T00916                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00010  Glycolysis / Gluconeogenesis
vap00020  Citrate cycle (TCA cycle)
vap00620  Pyruvate metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
Module
vap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_2163
   00020 Citrate cycle (TCA cycle)
    Vapar_2163
   00620 Pyruvate metabolism
    Vapar_2163
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Vapar_2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ACS18798
JGI: Vapar_2163
UniProt: C5CXE2
Position
1:2309257..2310927
Genome map
AA seq 556 aa AA seqDB search
MAAVEVKVPDIGDFDEVAVIEVLVKVGDTVKAEQSLITVESDKASMEIPSSTAGVVKELK
VEVGSKVKEGSVVLVLEADGAAAAAPAPAAAPAPAAAAPAPAAAAPAPAAAPAASGPVEV
KVPDIGDFKDVAVIELLVKPGDAIAADQSLITVESDKASMEIPSSAAGVLKELKVKVGDT
VNIGDLIAILEGAAGAAAPAPAQAAAAAPAAATASAPAPAAASPAPAASPAAAAAPHEPT
VAPTGNLPHASPSVRKFARELGVPLEEVKGSGPKGRITQEDVQGFTKAVMSGQASTKASA
AKAPAGGGADGAALGLIPWPKVDFTKFGTVERKDLSRIKKLSGANLHRNWVMIPHVTNND
EADITELEAFRVSTNKENEKSGIKVTMLAFVIKAVVAALKKFPDFNASLDGDQLVYKQYF
HIGFAADTPNGLVVPVLKDADKKGILQISQEMGELAKKARDGKLGSADMQGGCMSISSLG
GIGGTHFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGALAARF
NAYLGQVLADYRRILL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtggaagtcaaggtgccggacatcggcgatttcgatgaagtcgcggtgatc
gaggtgctcgtgaaggtgggcgacacggtcaaggccgagcagtcgctcatcaccgtggaa
tcggacaaggcgtcgatggagatcccgtcgtcgactgccggtgtggtcaaggaactgaag
gtcgaggtcggcagcaaggtgaaggagggctcggtggtgctcgtgctggaggccgatggt
gccgccgccgctgcgccggcgcctgcagcggccccggcccctgcggcggccgccccggca
cccgcagctgcggcgcctgcaccggctgccgcgcctgcggcctcgggcccggtcgaagtc
aaggtgcccgacatcggcgacttcaaggacgttgcggtcatcgagctgctggtgaagccc
ggcgacgcgatcgcggccgaccagtcgctgatcacggtggagtcggacaaggcctcgatg
gagattccgtcgtcggcggccggcgtgctcaaggagctcaaggtcaaggtgggcgacacg
gtcaacatcggcgacctgatcgcgatattggaaggcgcggcaggtgccgcggcaccggcg
cccgcgcaagctgctgcagccgcgcccgctgcggcaaccgccagtgcacccgcgccggcc
gccgcatcgccggcaccggctgcaagcccggctgccgcagccgcgccgcatgagccgacg
gtcgcgcccactggcaacctgccgcatgcctcgccctcggtgcgcaagttcgcacgcgag
ctcggcgtgccgctcgaggaggtcaagggctccggtcccaagggccgcatcacgcaggaa
gacgtccagggcttcaccaaggccgtgatgagcggccaggccagcaccaaggcctcggcg
gccaaggcgccggccggcggcggcgcggacggcgccgcgctcggcctcattccctggccc
aaggtcgacttcacgaagttcggcacggtcgagcgcaaggacctgtcgcgcatcaagaag
ctcagcggcgccaacctgcaccgcaactgggtgatgatcccgcacgtcaccaacaacgac
gaggccgacatcaccgagctcgaggccttccgcgtctccaccaacaaggagaacgagaag
tcgggcatcaaggtcacgatgctggccttcgtgatcaaggcggtggtggcggcgctgaag
aaattccccgacttcaacgccagcctcgacggcgaccagctggtctacaagcagtacttc
cacatcggcttcgcggccgacacgcccaacgggctcgtggtgccggtgctcaaggatgcc
gacaagaagggcatcctgcagatcagccaggaaatgggcgaactcgccaagaaggcgcgc
gacggcaagctcggctcggccgacatgcagggcggctgcatgtcgatcagctcgctcggc
ggcatcggcggcacgcacttcacgcccatcatcaacgcccccgaagtggccatcctcggt
ctctccaagggccagatgaagccggtgtgggacggcaagcagttcgtgccgcgcctcacg
ctgccgctgtcgctgtcgtacgaccaccgcgtgatcgatggtgccctggctgcgcgcttc
aacgcctacctgggccaggtgctcgcggactatcgccgaatcctgctatga

DBGET integrated database retrieval system