KEGG   Variovorax paradoxus S110: Vapar_2172Help
Entry
Vapar_2172        CDS       T00916                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vap  Variovorax paradoxus S110
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_2172
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_2172
  Amino acid metabolism
   00310 Lysine degradation
    Vapar_2172
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Vapar_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2322054..2323313
Genome map
AA seq 419 aa AA seqDB search
MSIVEVKVPQLSESVAEATMLTWKKKAGEAVAVDEILIEIETDKVVLEVPAPSAGVLAEI
VQPDGATVVADQLIAKIDTEGKASAAAPAAAAPAAAPAPAAAPAAAAAATGGSKSDVAMP
AAAKLLADNNLKTSDVAGSGKDGRVTKGDVLGAVASGAKPAPAVAAPAAKPALPQVAAPA
GAPDLGERPEQRVPMSRLRARIAERLIQSQSTNAILTTFNEVNMAPVMELRKRFQDSFTK
EHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDILYHGYFDIGIAVGSPRGLVVPILRN
ADQMSFADIEKKIAEYGKKAQDGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFDI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgtagaagtcaaagtcccccagctttccgaatccgtggccgaagccaccatg
ctcacctggaagaagaaggccggcgaagccgtcgccgtcgatgaaatcctgatcgagatc
gagaccgacaaggtcgtgctcgaggtgcccgcgccctcggctggcgtgctggccgagatc
gtgcagcccgatggcgccaccgtggtggccgaccagctgatcgcgaagatcgacaccgaa
ggcaaggcaagcgctgcagcgcctgcagcagcggcacccgccgccgcaccggccccggca
gctgcgcccgcagcggctgcggccgccaccggcggttcgaagtccgacgttgccatgccc
gccgccgccaagctgctggccgacaacaacctgaagaccagcgacgtggccggcagcggc
aaggacggccgcgtcaccaagggcgacgtgctcggcgccgtggcttcgggcgccaagccc
gcgcccgccgtggctgcaccggccgccaagcccgcgctgccgcaagtcgccgcgcccgcg
ggtgcgcccgacctgggcgagcgccccgagcagcgcgtgccgatgagccgcctgcgcgcc
cgcatcgccgagcgcctgatccagtcgcaatcgaccaacgcgatcctgacgaccttcaat
gaagtcaacatggcgcccgtcatggagctgcgcaagcgcttccaggacagcttcaccaag
gagcatggcgtgaagctcggcttcatgagcttcttcgtgaaggccgcggtgcatgcgctc
aagaagtacccggtgatcaacgcctcggtcgacggcaacgacatcctgtaccacggctac
ttcgacatcggcattgccgtcggttcgccgcgcggcctggtggtgccgatcctgcgcaac
gccgaccagatgagctttgccgacatcgagaagaagatcgccgaatacggcaagaaggca
caggacggcaagctcggcatcgaagagatgaccggcggcaccttctccatctcgaacggc
ggcaccttcggctcgatgctctcgacgccgatcatcaacccgccccagtcggccatcctc
ggcgtgcacgccaccaaggaccgcgccgtggtcgagaacggccagatcgtggttcgcccg
atgaactaccttgccatgagctacgaccaccgcatcatcgacggccgcgaagccgtgctg
ggcctggtggccatgaaggaagcgctcgaagacccgtcgcgcctgctgttcgacatctga

DBGET integrated database retrieval system