KEGG   Variovorax paradoxus S110: Vapar_2205Help
Entry
Vapar_2205        CDS       T00916                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vap  Variovorax paradoxus S110
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vap01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2354918..2355475)
Genome map
AA seq 185 aa AA seqDB search
MILVLGDSLSAEYGLKRGEGWVPLLEKRLAQQKIPATVVNASISGDTSSGGRARFASLLA
QHKPTHVVVELGANDALRGLPLQNTEDNLLQITKAAQAAGAKVLIVGIQVPPNYGGDYTR
RFEAVFGKVASTTKAALVPFLLKGVADAPDALALFQADRIHPTAAAQPQLLDNVWPELRK
LLAAK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctggtgcttggcgattcgctgagcgccgagtacggcctcaagcgcggcgaaggc
tgggtgcccctgctcgagaagcgcctcgcccagcagaagatcccggccacggtggtcaat
gccagcatcagcggcgacaccagctcgggcggacgggcccgctttgcctcgctgctggcg
cagcacaagcccacccatgtggtggtcgagctgggtgccaacgatgcgctgcgcggcctg
ccgctgcagaacaccgaggacaacctgctgcagatcaccaaggcggcgcaggcggccggc
gccaaggtgctgatcgtcggcatccaggtgccgcccaattacggcggcgactacacgcgg
cgcttcgaggccgtgttcggcaaggtggccagcaccaccaaggcggcgctggtgcccttc
ctgctcaagggcgtggccgatgcgcccgacgcgctggcgctgttccaggccgaccgcatc
catcccacggccgccgcgcagccgcaactgctcgacaacgtctggccggaactgcgcaag
ctgctcgccgccaagtag

DBGET integrated database retrieval system