KEGG   Variovorax paradoxus S110: Vapar_2332Help
Entry
Vapar_2332        CDS       T00916                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vap  Variovorax paradoxus S110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Vapar_2332 (recR)
DNA repair and recombination proteins [BR:vap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Vapar_2332 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2496949..2497539
Genome map
AA seq 196 aa AA seqDB search
MADASSLDALVDALRRLPGVGVKSASRMAFHLLQHDREGAQLLARALQQAAGNVRHCERC
NTFTEAPVCSVCLDARRDASKLCVVETPADQAALERTGAFRGYYFVLMGKLSPLDGIGPK
DIGLQKLFDRALDGTVSEVILATNFTAEGEATAHVIGEALRQRGLNVTRLARGVPAGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccagttcgctcgatgcgctggtcgatgcgctgcgccgcctgcccggcgtc
ggcgtcaagtcggcctcgcgcatggccttccacttgctgcagcacgaccgcgagggcgcg
cagctgcttgcgcgcgcgctgcagcaggcggccggcaacgtgcggcattgcgaacgctgc
aacaccttcaccgaagcaccggtctgcagcgtgtgcctcgacgcgcgccgcgacgcaagc
aagctctgcgtggtcgagacgccggccgaccaggccgcgctcgaacgcaccggggccttc
cgcggctactacttcgtgctgatgggcaagctcagtccgctcgacggcatcggacccaag
gacatcggcctgcagaagctcttcgaccgcgcgctggacggcaccgtgagcgaggtcatc
ctggccaccaacttcacggcggagggcgaagccaccgcgcacgtgatcggcgaagcgctc
cggcagcgcggcctcaacgtgacgcgcctcgcgcgcggcgtgcctgccggcagcgaactc
gaatacgtggatctcggcaccatcgcgcatgccctggtggaccgccgatag

DBGET integrated database retrieval system