KEGG   Variovorax paradoxus S110: Vapar_2332Help
Entry
Vapar_2332        CDS       T00916                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
vap  Variovorax paradoxus S110
Pathway
vap03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Vapar_2332
DNA repair and recombination proteins [BR:vap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Vapar_2332
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Vapar_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ACS18959
JGI: Vapar_2332
UniProt: C5CYK0
Position
1:2496949..2497539
Genome map
AA seq 196 aa AA seqDB search
MADASSLDALVDALRRLPGVGVKSASRMAFHLLQHDREGAQLLARALQQAAGNVRHCERC
NTFTEAPVCSVCLDARRDASKLCVVETPADQAALERTGAFRGYYFVLMGKLSPLDGIGPK
DIGLQKLFDRALDGTVSEVILATNFTAEGEATAHVIGEALRQRGLNVTRLARGVPAGSEL
EYVDLGTIAHALVDRR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccagttcgctcgatgcgctggtcgatgcgctgcgccgcctgcccggcgtc
ggcgtcaagtcggcctcgcgcatggccttccacttgctgcagcacgaccgcgagggcgcg
cagctgcttgcgcgcgcgctgcagcaggcggccggcaacgtgcggcattgcgaacgctgc
aacaccttcaccgaagcaccggtctgcagcgtgtgcctcgacgcgcgccgcgacgcaagc
aagctctgcgtggtcgagacgccggccgaccaggccgcgctcgaacgcaccggggccttc
cgcggctactacttcgtgctgatgggcaagctcagtccgctcgacggcatcggacccaag
gacatcggcctgcagaagctcttcgaccgcgcgctggacggcaccgtgagcgaggtcatc
ctggccaccaacttcacggcggagggcgaagccaccgcgcacgtgatcggcgaagcgctc
cggcagcgcggcctcaacgtgacgcgcctcgcgcgcggcgtgcctgccggcagcgaactc
gaatacgtggatctcggcaccatcgcgcatgccctggtggaccgccgatag

DBGET integrated database retrieval system