KEGG   Variovorax paradoxus S110: Vapar_2493Help
Entry
Vapar_2493        CDS       T00916                                 

Definition
glycoside hydrolase family 24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
vap  Variovorax paradoxus S110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2633880..2634380
Genome map
AA seq 166 aa AA seqDB search
MDAANLKTSAEGHTIMHYFEQCRLEAYPDPGTGGAPWTIGWGDTGPDVVPGLVITQEEAD
QRYANRLHREFEPGVVDLLQREPTQAQFDALVSLAYNIGLANFRGSTVLRKFNQGDDIGA
ADAILMWNKAGGKVMLGLKRRRTAERARFLGASGKQATAVGAAVSS
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagccaacctgaagacctcggccgagggccacaccatcatgcattacttcgag
cagtgccggctcgaggcgtatccagatcctggcaccggtggggcgccgtggacgatcgga
tggggcgacaccgggcccgatgtggtgcctgggctcgtcatcacccaggaagaggccgac
cagcgctatgcgaatcgcctgcaccgggaattcgagcctggcgtggtcgacctgctgcag
cgcgagccgacacaagcccagttcgatgccctcgtctcgctggcatacaatatcgggctt
gccaacttccggggctcaacggtcctgcgcaagttcaatcagggcgacgacatcggcgcg
gccgacgcgatcctgatgtggaacaaggcaggcggcaaggtcatgctcggcctgaagcgg
cgccggaccgcggagcgcgcgcggttcctcggcgccagtggcaagcaagcaaccgccgtc
ggcgccgcggtgtcgtcatga

DBGET integrated database retrieval system