KEGG   Variovorax paradoxus S110: Vapar_2526Help
Entry
Vapar_2526        CDS       T00916                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vap  Variovorax paradoxus S110
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Vapar_2526
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Vapar_2526
   00620 Pyruvate metabolism
    Vapar_2526
   00640 Propanoate metabolism
    Vapar_2526
  Energy metabolism
   00680 Methane metabolism
    Vapar_2526
Enzymes [BR:vap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Vapar_2526
Lipid biosynthesis proteins [BR:vap01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Vapar_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2667160..2669160
Genome map
AA seq 666 aa AA seqDB search
MSSSASKNIESVLVENRVFPPDARASAGARIAGMAAYEALCQEAEQDFEGFWSRLARENL
SWTQPFTKTLDESNAPFYQWFGDGELNASANCLDRHIGTPVEHKTAIVFEADDGAVTRVS
YKELLARVSQFANALKAAGIGKGDRVIIYMPMTIEGVVAMQACARIGATHSVVFGGFSAK
ALQERIIDAGAVAVITANYQLRGGKELPLKAIVDDGIALGGCESIRTVFVYERTASAWAR
VEGRDKTFAEALQGQITDCPPVPVNAEHPLFILYTSGSTGKPKGVQHATGGYLLWARLTM
DWTFDIRPEDVFWCTADIGWITGHTYVAYGPLAAGATQVVFEGIPTFPHAGRFWQMIERH
QVSVFYTAPTAIRSLIKAAESDEKVHPRNWNLDSLRILGSVGEPINPEAWMWYHRNIGHE
KCPIVDTFWQTETGGHVITPLPGATPLVPGSCTLPLPGIMAAIVDETGKDLPNGAGGMLV
IKRPWPSMIRTIWNDPERFRKSYFPEEMGGTIYLAGDGAVRSADRGYFRITGRIDDVLNV
SGHRLGTMEIESALVSKTDLVAEAAVVGRPDDVTGEAVCAFVVLKRGRPSGEEAKQIANE
LRAWVAKEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSIAKGEAITQDISTLENPAILE
QLSQTN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcgcatcgaagaacatcgaatccgtcctggtcgagaaccgcgtgttcccc
cccgacgcccgcgccagcgctggcgcgcgcattgccggcatggccgcctacgaggccctg
tgccaggaggccgaacaggacttcgaaggcttctggagccgcctggcgcgcgagaacctg
agctggacccaacccttcacgaagacactcgacgaatccaacgcccccttctaccaatgg
ttcggcgacggcgaactcaacgccagcgccaactgcctggaccgccacatcggcaccccc
gtcgaacacaagaccgccatcgtcttcgaagccgacgacggcgccgtcacccgcgtcagc
tacaaggaactgctcgcccgcgtgagccagttcgccaacgccctgaaggccgccggcatc
ggcaagggcgaccgcgtcatcatctacatgcccatgaccatcgagggcgtggtcgccatg
caggcgtgcgcgcgcatcggcgccacccacagcgtcgtgttcggcggcttctccgccaag
gccctgcaggagcgcatcatcgacgccggcgccgtggccgtcatcaccgccaactaccag
ctgcgcggcggcaaggagctgcccctcaaggccatcgtcgacgacggcatcgccctgggc
ggctgcgaatccatccgcaccgtcttcgtctacgaacgcaccgccagcgcctgggcgcgt
gtcgaaggccgcgacaagaccttcgccgaggcgctccagggccaaatcaccgactgcccg
cccgtgccggtgaatgccgagcaccccctcttcatcctctacacctccggctccaccggc
aagcccaagggcgtgcagcacgccaccggcggctacctgctgtgggcccggctcaccatg
gactggaccttcgacatccggcccgaggacgtcttctggtgcaccgccgacatcggctgg
atcaccggccacacctacgtcgcctacggcccgctcgccgccggcgccacccaggtcgtg
ttcgagggcatccccaccttcccgcacgccgggcgcttctggcagatgatcgagcggcac
caggtcagcgtcttctacaccgcccccaccgccatccgctcgctcatcaaggccgccgaa
tcggacgagaaggtgcaccccaggaactggaacctggacagcctgcgcatcctcggctcg
gtcggcgagcccatcaaccccgaggcctggatgtggtaccaccggaacatcggccatgag
aaatgtccgatcgtcgacaccttctggcagaccgagaccggcggccacgtcatcacgccc
ttgccgggcgccacgccgctggtgccgggctcgtgcaccctgccgctgccgggcatcatg
gccgccatcgtggacgagaccggcaaggacctgcccaacggcgcgggcggcatgctggtc
atcaagcggccctggccctcgatgatccgcaccatctggaacgaccccgagcgcttcagg
aagagctacttccccgaggagatgggcggcaccatctacctggccggcgacggcgcggtg
cgcagtgccgaccgcggctacttccgcatcaccgggcgcatcgacgacgtgctgaacgtc
tcgggccaccgcctgggcacgatggagatcgaatcggcgctggtgtccaagaccgacctg
gtggccgaggcggcggtggtggggcggcccgacgacgtgacgggcgaggcggtgtgcgcc
ttcgtggtgctcaagcgcgggcgcccgagcggcgaggaggccaagcagatcgccaacgaa
ctgcgcgcctgggtggccaaggagatcggcccgatcgccaagcccaaggacatccgcttc
ggcgagaacctgcccaagacgcgcagcggcaagatcatgcggcgcctgttgcgcagcatc
gccaagggcgaggccatcacgcaggacatctcgacgctggaaaatccggcgatcctggag
cagttgtcacagaccaactga

DBGET integrated database retrieval system