KEGG   Variovorax paradoxus S110: Vapar_2536Help
Entry
Vapar_2536        CDS       T00916                                 

Definition
Malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
vap  Variovorax paradoxus S110
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vap00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:vap00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2676872..2678356
Genome map
AA seq 494 aa AA seqDB search
MSATEWFQARLRSGEKSGEKAAARVPVASDGAARGAPKSAARPSMRSTAERLQATLRKAD
EALSPRALRRVLTALQAVIDPRVSEVEGGRRAHAIAREYAAATPEERRDYWALMSEHFAA
DPHKLKSARDQHQAAVGTPDEGQAELRLRRALVSPRMRLLQRFAVEPEGMRFLVDLRAEL
LPFLKSDKRLLALDAELEHLFSTWFDVAFLELRRIDWHSPASLIEKLIRYEAVHDIKSWT
DVKNRLDDSDRRCYGFFHPRLPNEPLIFVEVALVDRISDGITPLLDEAAVPIQPAKATTA
IFYSISNTQTGLRGVSFGDSLIKRVVETLQEELPRLKTFATLSPIPGFRSWLARNAAELL
PRLDEKREAELGRLVGSLPPTAERLLAAVEAPATLDAKSPLRQWLLQAAAEYLGRTLVDG
TPADPVARFHLGNGARVERLNWAGDPSPKGLKQSYGLMVNYLYDLKRLDKHRAWIAEGKV
AVSGDVESLFFKKG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaccgagtggttccaggcgcgattgcgctctggcgaaaagtccggcgaaaag
gccgcagccagggtgcccgtggcatccgacggcgcggcccgcggcgcacccaagtcggcc
gcaagacccagcatgcgctcgaccgccgagcggctgcaggccacgctgcgcaaggccgac
gaggccctgtcgccgcgcgcgctgcgccgcgtgctcacggcgctgcaggcggtgatcgat
ccgcgcgtgagcgaggtcgagggcgggcgccgggcccatgccattgcacgcgaatatgcc
gccgccacgcccgaggagcggcgcgactactgggcgctcatgagcgagcatttcgcggcc
gatccgcacaagctcaagtccgcgcgcgaccagcaccaggccgccgtgggaacgcccgac
gaaggacaggccgaactgcggctgaggcgcgcgctggtgtcgccgcgcatgcgcctcttg
cagcgttttgcagtcgagcccgagggcatgcgcttcctggtcgacctgcgcgccgagctg
ctgccgttcctcaagtcggacaagcggctgctcgcgctcgatgccgaactggagcacctg
ttctccacctggttcgacgtcgccttccttgaattgcgacggatcgactggcattcgccg
gcgtcgctgatcgagaagctgatccgctacgaggccgtgcacgacatcaagagctggacc
gacgtgaagaaccggctcgacgacagcgaccgccgctgctacggcttcttccatccgcgg
ctgcccaacgagccgctgatcttcgtcgaggtggcgctggtcgaccgtatcagcgacggc
atcacgccgctgctcgacgaggccgccgtgccgatccagccggccaaggccaccaccgcc
atcttctattcgatcagcaacacgcagaccgggctgcgcggcgtgagctttggcgattcg
ctcatcaagcgcgtggtcgagacgctgcaggaagagctgccgcgcctgaagacctttgcc
acgctgtcgccgatcccgggctttcgcagctggctcgcccggaatgccgccgagctgctg
ccgcgcctggacgagaagcgcgaggccgagctcggccgcctcgtcggctcgctgccgccg
accgccgagcggctgcttgccgcggtggaggcgccggccacgctcgatgccaagtcgccg
ctgcgccagtggctgctgcaggccgcggccgaatacctgggccgcacgctggtcgacggc
acgccggccgatccggtggcgcgttttcacctgggcaacggcgcgcgcgtggagcgcctc
aactgggccggcgatccttcgcccaaggggctgaagcagtcctacggcctgatggtcaat
tacctctacgatctcaagcgcctcgacaagcatcgggcatggatcgccgagggcaaggtg
gcggtttcgggggatgtggaaagcctgttcttcaaaaaaggctga

DBGET integrated database retrieval system