KEGG   Variovorax paradoxus S110: Vapar_2649Help
Entry
Vapar_2649        CDS       T00916                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00020  Citrate cycle (TCA cycle)
vap00480  Glutathione metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
vap01210  2-Oxocarboxylic acid metabolism
vap01230  Biosynthesis of amino acids
Module
vap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vap_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_2649
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_2649
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Vapar_2649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACS19274
JGI: Vapar_2649
UniProt: C5CKX0
Position
1:2790679..2791938
Genome map
AA seq 419 aa AA seqDB search
MSSYQHIKVPAEGQKITVNADNSLNVPDQPIIPFIEGDGTGLDITPVMLKVVDAAVAKAY
GGKKKIHWMEVYAGEKSTKVYGPDVWLPEETLHAVRDYVVSIKGPLTTPVGGGIRSLNVA
LRQELDLYVCLRPIQYFEGVPSPVREPHKTNMVIFRENSEDIYAGIEFEAESDKAKKLIK
FLQDELGVKKIRFPNTSGIGVKPVSKEGTERLVRKALQYAVDNDKPSVTIVHKGNIMKFT
EGGFRDWAYALAAKEFGAELIDGGPWMKFKNPKTGKEITVKDSIADAFLQQILLRPAEYS
VIATLNLNGDYVSDALAAQVGGIGIAPGANLSDTVAMFEATHGTAPKYAGKDYVNPGSEI
LSAEMMLRHMGWTEAADLIISSMEKSIASKKVTYDFARLMDGATQVSCSGFGQVMIDHM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctaccagcacatcaaagtcccggccgaaggccagaagatcacggtcaacgcc
gacaactcgctcaatgtgcctgatcagccgatcattcccttcatcgaaggcgacggcacg
ggtctggacatcactccggtgatgctcaaggtggtggatgctgcagtggccaaggcctac
ggcggcaagaagaagatccactggatggaagtctatgccggcgaaaagtcgaccaaggtc
tacggccccgacgtctggctgcccgaggaaacgctgcacgccgtgcgcgactacgtggtg
tccatcaagggtccgctcaccacgcccgtcggcggcggcatccgctcgctgaacgttgcg
ctgcgccaggaactcgacctctacgtctgcctgcgccccatccagtatttcgagggcgtg
cccagcccggtgcgcgagccgcacaagaccaacatggtcatcttccgcgagaactcggaa
gacatctatgccggcatcgagttcgaagccgaaagcgacaaggccaagaagctcatcaag
ttcctgcaggacgaactgggcgtcaagaagatccgcttccccaacacctcgggcatcggc
gtcaagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgctgcagtacgcg
gtggacaatgacaagcccagcgtcacgatcgtgcacaagggcaacatcatgaagttcacc
gaaggtggcttccgcgactgggcctatgccctggcggccaaggagttcggcgccgagctg
atcgacggcggcccctggatgaagttcaagaatcccaagacgggcaaggaaatcaccgtc
aaggacagcatcgccgacgcattcctgcagcagatcctcctgcgccccgccgaatacagc
gtgatcgccacgctcaacctgaacggcgactacgtgtccgacgcgctggcagcccaggtg
ggcggcatcggcattgccccgggcgcgaacctgagcgacaccgtcgccatgttcgaagcc
acccacggcacggctcccaagtacgccggcaaggactacgtgaaccccggttccgaaatc
ctctcggccgagatgatgctgcgccacatgggctggaccgaagcggccgacctgatcatc
agctcgatggaaaagtcgattgccagcaagaaggtcacctatgacttcgcccgcctgatg
gacggcgccacgcaggtgagctgctcgggcttcggccaggtcatgatcgaccacatgtaa

DBGET integrated database retrieval system