KEGG   Variovorax paradoxus S110: Vapar_2652Help
Entry
Vapar_2652        CDS       T00916                                 

Definition
(GenBank) phospholipase D/Transphosphatidylase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00564  Glycerophospholipid metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Vapar_2652
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Vapar_2652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc PLDc_N HlyIII BON
Motif
Other DBs
NCBI-ProteinID: ACS19277
JGI: Vapar_2652
UniProt: C5CLM0
Position
1:2795103..2796548
Genome map
AA seq 481 aa AA seqDB search
MILPELSQEWKTGLSLAWSGYIAVLSVWIVMQKRAPVSTMSWILSLALLPFAGFVIYYFL
GPQRLRKQRVKRLRSRASAHTQADLARLRDAAQNAPPALQQMARLGTAACGLPVSSATGV
ALLSGGARTFDAIFDAVRAARDHVHLEYYIFEPDRIGTALRDLLVERAGQGVSVRLLLDA
LGSKRIGRKFMAPLHAAGVQVALFHDTRIGRRLRPVTNYRTHRKIVVCDGRVGFTGGVNI
TDEEDKRTRPDAYHDVHLRIEGSAVRWLQTTFLEDWTYATGEDLRDIDHLMGAMLPQVEA
GDIPVQIVTSGPDNMLEPIHRMHVEAIHSASERAWLTTPYFVPGEPAMMALTSAALRGVD
VRLLVPRRSDSAIVSAAARSYFDELIASGVKVWEYKARMLHSKTLVVDDHCAMIGTANFD
NRSFRLNFEVSAVVYGPELARPLAAQFETDLHSSGAVRAHRPQSFWRRLGDALARLFSPL
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctccccgagctcagtcaggaatggaaaaccggcctctctctggcctggagcggc
tatatcgccgtgctgtcggtctggatcgtgatgcagaagcgtgcgccggtgtccaccatg
agctggatcctgtcgctcgcgctgctgccgttcgcgggcttcgtcatctattacttcctc
gggccgcagcgcctgcgcaagcagcgcgtcaagcgcctgcgcagccgggccagcgcgcac
acgcaggccgacctggcgcggctgcgcgacgcggcgcagaacgcgccgccggcgctgcag
cagatggcgcggctgggcaccgcggcctgcgggctgccggtttccagcgcgacgggcgtg
gcgctgctctcgggcggcgcgcgcaccttcgacgccatcttcgacgcggtgcgcgcggcg
cgcgaccacgttcacctcgagtactacatcttcgagcccgacaggatcggcaccgcgctg
cgcgacctgctggtggagcgcgccggccagggcgtgtccgtgcgcctgctgctcgacgca
ctgggttccaagcgcatcggccgcaagttcatggcgccgctgcatgccgcgggcgtgcag
gttgcgctcttccacgacacgcgcatcggccgccgcctgcgcccggtgaccaactaccgc
acccaccgcaagatcgtggtgtgcgacggccgcgtgggctttaccggcggcgtcaacatc
accgacgaggaagacaaacgcacccggcccgacgcctaccatgacgtccacctgcgcatc
gagggcagcgcggtgcgctggctgcagaccaccttcctggaggactggacctatgccacc
ggcgaagacctgcgcgacatcgaccacctgatgggcgccatgctgccgcaggtcgaggcc
ggcgacattcccgtgcagatcgtgaccagcggccccgacaacatgctggaacccatccac
cgcatgcacgtggaggcgatccattcggcgagcgagcgggcctggctcaccacgccgtac
ttcgtgcccggcgagcccgccatgatggcgctcaccagcgcggcgctgcgcggcgtggat
gtgcgcctgctggtgccgcggcgcagcgattcggccattgtgagcgcggccgcgcgctcc
tacttcgacgagctgattgcgtcgggagtcaaggtctgggaatacaaggcgcgcatgctg
cattccaagaccttggtggtcgacgaccattgcgcgatgatcggtaccgcgaatttcgac
aaccgcagcttcaggctcaatttcgaagtgagcgcggtggtctacggccccgagctggca
cgccccctggccgcgcagttcgagaccgacctgcacagctccggcgcagtgcgcgcccac
cggccgcagagtttctggcgccgcctcggcgacgcgcttgcacgattgttttcccccttg
ctctga

DBGET integrated database retrieval system