KEGG   Variovorax paradoxus S110: Vapar_2684Help
Entry
Vapar_2684        CDS       T00916                                 

Definition
(GenBank) phosphoribosylamine/glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00230  Purine metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01130  Biosynthesis of antibiotics
Module
vap_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Vapar_2684
Enzymes [BR:vap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     Vapar_2684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATPgrasp_Ter ATP-grasp_3 ATP-grasp CPSase_L_D2 RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACS19309
JGI: Vapar_2684
UniProt: C5CLQ2
Position
1:2827422..2828720
Genome map
AA seq 432 aa AA seqDB search
MKVLVIGGGGREHALAWRLAQASRVSRVYVAPGNGGTVSDERYDCIDITEPAALREWAAK
EKIALTVVGPEAPLAAGVVDEFRAHGLRIFGPTQAAAQLESSKAFSKAFMKRHKIPTAEY
EAFTDAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMTAQEAHEAVDFMLVDNKFGVSHN
DGGARVVIEEFLQGEEASFIVLCDGKNVTALATSQDHKRLLDNDEGPNTGGMGAYSPAPV
VTAEVHARAMREIILPTIRGMEKDGIPYTGFLYAGLMIDATGHPKTLEFNCRMGDPETQP
IMMRLKSDLFEVFWHATDGTLDQVELQWDRRVALGVVMAAHGYPLSPRKGDRITGIPPEA
PDAVVFHAGTTQQDGELKTSGGRVLCVTVLADSVKLAQQRAYEVAARIGFDGAQYRKDIG
HRAVHARNTPHA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtactggtaattggaggagggggccgggagcacgcactggcgtggcggctggcg
caggccagccgggtcagccgcgtgtacgtggcgccgggcaacggcggcaccgtgagcgac
gagcgctacgactgcatcgacatcaccgagcccgccgcgctgcgcgagtgggctgccaag
gaaaagatcgcgctcaccgtcgtcgggcccgaggcgccgctggcagcgggcgtggtcgac
gaattccgcgcgcacggcctgcgcatcttcggccccacgcaggccgccgcgcagctcgag
agctccaaggccttctccaaggccttcatgaagcgccacaagattcccacggccgagtac
gaggccttcaccgatgccgcggcggcgcacgcctacatcgacgccaagggcgcgccgatc
gtcgtcaaggccgacggcctggccgccggcaagggcgtggtagtggccatgaccgcgcag
gaggcgcacgaggcggtcgacttcatgctggtcgacaacaagttcggcgtctcgcacaac
gacggcggcgcgcgcgtcgtcatcgaggaattcctgcagggcgaggaagccagcttcatc
gtgctgtgcgacggcaagaacgtgaccgcgctggccaccagccaggaccacaagcgcctg
ctcgacaacgacgaaggccccaacaccggcggcatgggcgcctactcgcccgcgcccgtg
gtcacggccgaggtgcatgcgcgcgcaatgcgcgaaatcatcctgccgaccatccgcggc
atggaaaaggacggcatcccgtacaccggcttcctctacgccggcctcatgatcgacgcc
accggccatcccaagacgctcgagttcaactgccgcatgggcgaccccgagacgcagccg
atcatgatgcggctcaagtccgacctgttcgaggtgttctggcatgccaccgacggcacg
ctcgaccaggtcgagctgcagtgggaccggcgcgtggcgttgggcgtggtgatggcggcg
cacggctatccgctctcgccgcgcaagggcgaccgcatcaccggcattccgcccgaggcg
cccgatgccgtggtgttccacgcgggcaccacccagcaggacggcgagctcaagaccagc
ggcggccgcgtgctgtgcgtgaccgtgctggccgacagcgtgaagctcgcgcagcagcgg
gcctacgaggttgccgcgcgcatcggcttcgacggcgcgcaataccgcaaggacatcgga
caccgcgcggtccacgcgcgcaacaccccgcacgcctga

DBGET integrated database retrieval system