KEGG   Variovorax paradoxus S110: Vapar_2686Help
Entry
Vapar_2686        CDS       T00916                                 

Definition
(GenBank) nicotinate (nicotinamide) nucleotide adenylyltransferase
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00760  Nicotinate and nicotinamide metabolism
vap01100  Metabolic pathways
Module
vap_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Vapar_2686
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Vapar_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ACS19311
JGI: Vapar_2686
UniProt: C5CLQ4
Position
1:2829634..2830263
Genome map
AA seq 209 aa AA seqDB search
MNPSGTAPRIGIFGGAFDPPHNAHVALAEAALAQLDLAELHVVPTGQAWHKSRALTPKED
RLAMARLAFGGLKGTVVIDSREVLRDGPTYTLDTLHELQREQPGAQLVLIMGADQAGALP
TWHGWQAILGIAIVSVAYRALSTGGTARFDPKMLPGLPAGARFEALELPAMDTSATDIRR
RAALGEDISSLVPSAVARYIDQHHLYRPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccttccggcacggccccgcgcatcggcatcttcggcggcgccttcgacccgccg
cacaacgcccatgtcgcgctggccgaggccgcattggcgcagctcgacctcgccgaactg
cacgttgttcccacgggccaggcctggcacaagagcagggcgctgacgccgaaggaagat
cgcctggcaatggcccgcctggctttcggcggattgaagggcacggtcgtcatcgacagc
cgcgaagtgttgcgcgacggccccacctacacgctcgacaccctgcatgaattgcagcgg
gaacagcccggcgcccagctggttctcatcatgggtgccgaccaggccggcgcattgccg
acatggcacggctggcaggctatactcggcattgctattgtttctgtagcgtatcgcgca
ttatcgacgggcggcactgctcgttttgatccgaagatgctgcccggcctgccggctggc
gcgcgtttcgaggcgctcgaattgccggccatggacaccagcgccaccgacatccggcgg
cgtgcggcgcttggcgaggacatttcctcgctggttccgtccgccgttgcacgctatatt
gaccaacaccacctttaccgccctgcctga

DBGET integrated database retrieval system