KEGG   Variovorax paradoxus S110: Vapar_2690Help
Entry
Vapar_2690        CDS       T00916                                 

Definition
(GenBank) ribonuclease, Rne/Rng family
  KO
K08301  ribonuclease G [EC:3.1.26.-]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     Vapar_2690
Messenger RNA biogenesis [BR:vap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Vapar_2690
Ribosome biogenesis [BR:vap03009]
 Prokaryotic Type
  rRNA processing factors
   Vapar_2690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_E_G S1
Motif
Other DBs
NCBI-ProteinID: ACS19315
JGI: Vapar_2690
UniProt: C5CLQ8
Position
1:2832001..2833527
Genome map
AA seq 508 aa AA seqDB search
MQDILINWSPQETRVALVEHGAVQELHVERTLERGLVGNIYLGKVSRVLPGMQSAFIDVG
LERTAFLHVADIVAPFTPGSRPSAPAPERDHRNGGPMVPIEKQVFEGQSLLVQVIKDPIG
TKGARLSTQISIAGRLLVFLPQDNHIGVSQKIPSDQRESLRTRMLALIEAAAAADSGGVV
PANTGGFILRTNGEDSSDAELAEDIAYLRKTWSRIREASSKMPPMSLLHQDLSLLQRVLR
DMTSEDTQTIRIDSREQFEALLKFGLEYMPQAAGKLQHYKGERPIFDLYSVDEEIAKALG
RRVELKSGGYLVVDQTEALTTVDVNTGGFVGARNFDDTIFKTNLEAAQAIARQLRLRNLG
GIIIVDFIDMGRDDHREQVLAEFRKQLARDRVKTTAGGFSQLGLVEMTRKRTRESLAHML
CEPCAACGGQGIVKTARSVAYDAMREILREARQFTPREFRIVSSPQVIELFLDEESQHLA
GLSDFIGKPISLQSEPAIGQGQYDIVLL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacatcctgatcaactggtccccgcaggagacccgtgtggcgctggtcgagcac
ggcgcggtgcaagagctgcacgtcgaacgcacgctggagcgcgggctggtcggcaacatc
taccttggcaaggtgtcgcgcgtgctgccgggcatgcagtcggccttcatcgacgtcggc
ctcgagcgcacggccttcctgcacgtggccgacatcgtggcgccgttcacgccgggctcg
cggcccagtgcaccggcccccgagcgcgaccaccgcaacggcgggccgatggtgcccatc
gagaagcaggtgttcgaaggccagtcgctgctggtgcaggtgatcaaggacccgatcggc
accaagggcgcgcggctctccacgcagatcagcattgccggccggctgctggtgttcttg
ccgcaggacaaccacatcggcgtttcgcagaagatcccttcggaccagcgcgaatccttg
cgcacgcgcatgctcgcgctgatcgaggccgcagccgcggccgacagcggcggcgtggtg
cctgccaacaccggtggcttcatcctgcgcaccaacggcgaagattcgtccgacgccgag
ctggcagaagacatcgcctacctgcgcaagacctggtcgcgcatccgcgaggcgtcaagc
aaaatgccgccgatgtcgctgctgcaccaggacctgagcctgctgcagcgcgtgctgcgc
gacatgaccagcgaggacacgcagaccatccgcatcgattcgcgcgagcagttcgaggcg
ctgctcaagttcgggctcgaatacatgccgcaggcggccggcaagctgcagcactacaag
ggcgagcggccgatcttcgacctgtattcggtcgacgaggaaatcgccaaggcgctgggc
cggcgcgtcgaactcaagtcgggcggctacctcgtggtcgaccagaccgaggcgctcacc
acggtggacgtgaacaccggcggcttcgtgggcgcgcgcaatttcgacgacaccatcttc
aagaccaacctcgaggcggcgcaggccatcgcgcgccagctgcggctacgcaacctgggc
ggcatcatcatcgtcgacttcatcgacatggggcgcgacgaccatcgcgagcaggtgctg
gccgagttccgcaagcagctcgcgcgcgaccgcgtcaagaccacggcgggcggtttctcg
cagctcggcctggtcgagatgacgcgcaagcgcacgcgcgaatcgctggcccacatgctg
tgcgagccctgcgcggcctgcggcgggcagggcatcgtgaagacggcgcgcagcgtggcc
tacgacgccatgcgcgagatcctgcgcgaagcgcggcagttcacgccgcgcgagttccgc
atcgtgtcgtcgccgcaggtgatcgagctgttcctcgacgaggaaagccagcatctcgcg
gggctgagcgacttcatcggcaagccgatctcgctgcagtccgagcccgcgatcgggcag
ggccagtacgacatcgtgctgctctga

DBGET integrated database retrieval system