KEGG   Variovorax paradoxus S110: Vapar_2694Help
Entry
Vapar_2694        CDS       T00916                                 

Definition
(GenBank) tol-pal system protein YbgF
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_6 TPR_16 TPR_19 YfiO TPR_2 TPR_8 TPR_21 TPR_14 TPR_18 TPR_1 TolA_bind_tri ANAPC3 TPR_12 DUF2205 HemX CENP-F_leu_zip TPR_9 Spc7 DUF3450 ApoLp-III DUF5344 DUF3573 TBPIP GOLGA2L5 HOOK SOGA FapA Mod_r Tektin ADIP IncA DUF1664 V_ATPase_I Cnn_1N DUF5082 TMF_TATA_bd HAUS-augmin3 Phage_GP20 Atg14 DUF724 DUF2203 YabB Jnk-SapK_ap_N
Motif
Other DBs
NCBI-ProteinID: ACS19319
JGI: Vapar_2694
UniProt: C5CLR2
Position
1:2837341..2838090
Genome map
AA seq 249 aa AA seqDB search
MQHALLRGAALAAALLCVSAGSQAALFEDDEARRAILDLRQRVEAMRQQTDQRLTDENGQ
LRRSLLDLQNQIEQMRGDLARMTGQNEQLQRTVSEMQSRQATIDDRLKQNEPTKVSVDGR
EFTADPKEKADFDAALGIFRAGQFAQAQTAFAEFVKRYPQSGYNASALFWLGNAQYATRN
YNEAIANFRSMLSLAPDHAKAPEAVLSIANCQIELKDTRAARRTLEDLTKAYPQSEAAQA
GRERLSRLR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgccctgttgcgaggcgcggcgctggctgccgccttgctttgcgtttcggcc
ggctcgcaggccgcgttgttcgaggatgacgaggcacgccgcgccatcctcgacctgcgc
cagcgggtggaggccatgcgccagcagaccgaccagcggctgaccgacgaaaacggccag
ctgcgccgcagcctgctcgacctgcagaaccagatcgagcagatgcggggcgatctcgcg
cgcatgaccggccagaacgagcagctgcagcgcacggtcagcgagatgcagtcgcgccag
gccaccatcgacgaccggctcaagcagaacgagccgacgaaggtttcggtcgacggccgc
gagttcaccgccgatcccaaggaaaaggccgacttcgacgccgcgctcggcatcttccgt
gcgggccagttcgcgcaggcgcaaaccgcgtttgccgaattcgtcaagcgctacccgcaa
agcggctacaacgcctcggcgctgttctggctcggcaatgcgcagtacgccacgcgcaac
tacaacgaggccatcgcgaacttccgctccatgctgtcgcttgcgcccgaccacgccaag
gctcccgaggccgtgctgtcgatcgccaactgccagatcgagctgaaggacacgcgcgcc
gcgcgccgcacgctggaagacctgaccaaggcctatccgcaatccgaagccgcccaggct
ggccgcgagcgtctctcgcgcctgcgctag

DBGET integrated database retrieval system